KEGG   Escherichia coli O7 K1 CE10: CE10_3078Help
Entry
CE10_3078         CDS       T01999                                 

Gene name
lhgO
Definition
(GenBank) L-2-hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
eoc00310  Lysine degradation
eoc01100  Metabolic pathways
eoc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eoc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    CE10_3078 (lhgO)
Enzymes [BR:eoc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     CE10_3078 (lhgO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo Pyr_redox_2 Amino_oxidase NAD_binding_8 Lycopene_cycl Trp_halogenase FAD_binding_2 Thi4
Motif
Other DBs
NCBI-ProteinID: AEQ13820
UniProt: A0A0E0V9N1
Position
3141939..3143207
Genome map
AA seq 422 aa AA seqDB search
MYDFVIIGGGIIGMSTAMQLIDVYPDARIALLEKESGPAFHQTGHNSGVIHAGVYYTPGS
LKAQFCLAGNRATKAFCDQNGIRYDNCGKMLVATSELEMERMRALWERTAANGIEREWLN
AEELREREPNITGLGGIFVPSSGIVSYREVTAAMAKIFQARGGEIIYNAEVSALSEHKNG
VVIRTRQGGEYEASTLISCSGLMADRLVKMLGLEPGFIICPFRGEYFRLAPEHNQIVNHL
IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLAFKREGYRKRDFSFSDTLEILGSSGIRR
VLQNHLRSGLGEMKNSLCKSGYLRLVQKYCPRLSLSDLQPWPAGVRAQAVSPDGKLIDDF
LFVTTPRTIHTCNAPSPAATSAIPIGAHIVSKVQTLLASQSNPGRTLRAARSVDALHAAF
NQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtatgattttgtgattattggcggcggcatcatcggcatgtcgaccgccatgcaactg
attgatgtttatccggatgcccgcattgcgttgctggaaaaagagtccggcccggccttt
catcagacgggccacaacagcggcgtgatccatgccggggtctattacacgcccggtagc
ctgaaggcacagttttgcctggcgggaaaccgcgccaccaaagccttttgcgatcaaaac
ggcattcgctatgacaactgcggcaagatgctggtcgccacctctgaactcgaaatggaa
cggatgcgcgcgttgtgggaacgcacggcggcgaacggtatcgagcgcgagtggttaaac
gccgaggaactgcgcgagcgcgaaccgaatatcaccgggctcggcggcatttttgtgccg
tccagcggcattgtcagctatcgcgaagtgacggcggcgatggcaaaaatcttccaggcc
agaggcggcgagattatttataacgccgaagtcagcgccctcagtgagcataaaaacggc
gtggtgatacgtacccgtcagggcggtgaatatgaagcatcgacgctgattagctgttcc
gggctgatggctgaccggctggtgaaaatgctcggcctcgaaccgggctttattatctgc
ccgttccgtggcgagtatttccgccttgcgccggagcataaccagattgttaaccacctg
atttaccccattcccgaccccgcgatgccatttttgggcgtgcatctcacccgcatgatc
gatggcagcgtgaccgtcgggccaaacgcggtgctggctttcaaacgtgaaggctatcgc
aagcgcgacttctcatttagcgacacgctggagattttgggctcgtcggggattcgccgg
gtgctgcaaaaccatctacgctcaggactgggcgagatgaaaaactcgctgtgcaaaagc
ggctatctgcggctggtgcaaaagtattgtccccggctttcgttaagcgatctccagccc
tggcccgccggtgtgcgggcgcaggcggtatcgccggacggcaagctgattgacgatttt
ctgtttgtcaccaccccgcgcacgatccacacctgcaatgcgccctccccggcagcgaca
tcagcaattcctattggtgcgcatattgtcagcaaggtacaaacgctgttggcaagccag
agtaaccccggacgcacgctgcgagcggcacgtagtgtggatgccttacacgccgcattt
aatcaataa

DBGET integrated database retrieval system