KEGG   Escherichia coli O7 K1 CE10: CE10_3198Help
Entry
CE10_3198         CDS       T01999                                 

Gene name
scrB
Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
eoc00052  Galactose metabolism
eoc00500  Starch and sucrose metabolism
eoc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eoc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CE10_3198 (scrB)
   00500 Starch and sucrose metabolism
    CE10_3198 (scrB)
Enzymes [BR:eoc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CE10_3198 (scrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AEQ13934
UniProt: A0A0E0V8R9
Position
3253027..3254430
Genome map
AA seq 467 aa AA seqDB search
MPSQMPAILQAVMKGQSKALADAHYPCWHLAPVTGLMNDPNGFCWSGGRYHLFYQWNPLA
CDHKYKCWGHWSSTDLLHWQHEPLALMPDKEYDRNGCYSGSAVNNQGVLTLCYTGNVKFD
DGSRTAWQCLATENNQGGFDKLGPVIPLPDGYTGHVRDPKVWKHNSQWYMVLGAQDKEKR
GKVLLYSSVDLYTWSFHGEIAGNGLNEIDNAGYMWECPDFFALDGEYILLCCPQGMVREH
ERYLNTYPCAWLHGQFDYETGKFTHGAFSELDAGFEFYAPQTMEAPDGRRLLVGWMGVPD
GEEMLQPTRKHHWQHQMTCFRELSFQKGKLFQMPIRELAQLREAEHFWQGKADHAPHVEI
ERLEMDIIPSGELHLNFGNALALHLNDDGIQLQRKSLAGQEKLTRYWRGSVTSLKILCDS
SSIEIFINNGEGVMSNRYFPHHPASLILQGESDVTLHYWSLRACMVE
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgccttcacaaatgcccgcgattttacaggcagtgatgaaaggtcagtccaaagcactg
gcagatgcccactatccttgttggcatctcgctcccgtcaccggactaatgaacgatcca
aatggcttttgctggtctggaggccgctatcatctgttttatcagtggaatccactggct
tgtgatcataagtacaaatgttgggggcactggagttcgacggatttattgcactggcag
catgaaccattagcgctaatgcccgataaagagtacgaccgtaatggttgttactcagga
agcgcggttaataatcagggcgttctcacactttgctataccggtaatgttaagtttgat
gatggcagcagaacggcatggcaatgcctggccaccgaaaataaccagggcgggtttgat
aaactaggccctgtcataccgttacctgatggttacaccggacatgttcgtgatccaaaa
gtctggaagcacaacagccaatggtacatggtgcttggcgcgcaagataaagagaaacgg
gggaaagtgctgctgtattcctctgtcgatctctatacctggtcttttcatggagaaatt
gctggtaacggtctgaatgaaatagataacgcaggatacatgtgggaatgtcctgatttt
ttcgcccttgatggtgaatacattctcctctgttgcccccagggaatggtgcgcgaacat
gagcgctatctgaatacttatccctgcgcctggctacatggacagtttgattacgagaca
ggcaaatttacgcatggcgctttctcagagctggatgcgggatttgaattctatgcacca
cagacgatggaagccccggacgggcgacgattgctggtcggctggatgggggttcctgat
ggcgaagagatgttgcaaccaaccagaaagcatcattggcagcatcaaatgacctgtttt
cgcgaactctcattccagaagggaaaattgtttcagatgccaatcagggaactcgcgcaa
ctgcgtgaagctgaacacttctggcaaggaaaagcagatcatgcgccgcatgtcgaaatt
gaacgcctggaaatggacatcattccatcaggcgagctacatctgaattttggcaacgca
ctggcactgcatcttaatgacgatggtattcaactacagaggaaaagccttgcagggcaa
gagaaactaactcgttactggcgaggaagcgtaacgtcactgaagattctctgtgacagt
tccagcatagagatattcatcaataatggcgaaggcgtaatgagcaatcgttattttccc
catcatccagcttcgctgatattacagggcgagtctgacgtcacgttacactactggtcg
ctacgcgcctgcatggtagaatga

DBGET integrated database retrieval system