KEGG   Escherichia coli O7 K1 CE10: CE10_3233Help
Entry
CE10_3233         CDS       T01999                                 

Gene name
rlmM
Definition
(GenBank) putative RNA 2'-O-ribose methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
eoc  Escherichia coli O7:K1 CE10
Brite
KEGG Orthology (KO) [BR:eoc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:eoc03009]
    CE10_3233 (rlmM)
Enzymes [BR:eoc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     CE10_3233 (rlmM)
Ribosome biogenesis [BR:eoc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CE10_3233 (rlmM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ DUF4222 MIT_C
Motif
Other DBs
NCBI-ProteinID: AEQ13969
UniProt: A0A0E0V8V5
Structure
PDB: 

Position
complement(3292432..3293532)
Genome map
AA seq 366 aa AA seqDB search
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELP
FSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFC
RKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKF
PADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVD
NGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRE
TIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWAAVG
GRRDER
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggttgtattgctgtgccgtccgggctttgaaaaagagtgcgccgcagaaatt
accgataaagccggtcagcgggaaattttcggttttgcccgcgtgaaagagaatgcgggt
tatgtcatttatgaatgttatcaacctgatgatggcgataagttaatccgtgagctgccg
ttcagttcattaatttttgcccgccagtggtttgtggtgggggaactcctgcagcatttg
ccgccagaagatcgtattactcccattgtcggcatgttacagggcgtagtagagaagggc
ggtgaactgcgtgttgaagttgccgataccaacgaaagcaaagagttgctgaaattctgc
cgtaaattcaccgtgccgctacgcgctgccttgcgcgatgcgggtgtgctggcgaactat
gaaacgccgaagcgtccggttgtgcatgtattctttattgcaccaggctgctgctatacc
ggttactcatacagcaacaataattcgccgttctatatgggcattccgcgcctgaaattt
ccggcagatgcgccgagtcgttccacgctcaaactggaagaggcatttcatgtgtttatt
cctgcggatgagtgggatgaacgcctggcgaacgggatgtgggcggtggatttaggcgct
tgcccaggcggctggacctaccaactggtgaagcgcaacatgtgggtttattccgtcgac
aacggcccgatggcgcaaagtctgatggataccggacaggtgacgtggctgcgggaagac
ggtttcaaattccgtccgacacgcagcaatatctcctggatggtatgcgatatggttgaa
aaaccggcgaaagttgcggcattgatggcgcagtggctggttaatggctggtgccgtgaa
accattttcaacctcaaactgccgatgaaaaaacgctacgaagaagtgtcacacaatctg
gcgtatattcaggcacagcttgatgaacatggcataaatgctcagatccaggcgcggcag
ttgtatcacgatcgcgaagaagtgacggtgcacgtccgccgtatctgggctgcggtgggt
ggtcgtcgcgacgagcgataa

DBGET integrated database retrieval system