KEGG   Escherichia coli O7 K1 CE10: CE10_3307
Entry
CE10_3307         CDS       T01999                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase, Fe-S binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
eoc00230  Purine metabolism
eoc01100  Metabolic pathways
eoc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eoc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CE10_3307 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AEQ14036
UniProt: A0A0E0V9E4
Position
3372496..3372975
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgctggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system