KEGG   Escherichia coli O7 K1 CE10: CE10_3511Help
Entry
CE10_3511         CDS       T01999                                 

Definition
(GenBank) putative 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
eoc00780  Biotin metabolism
eoc01100  Metabolic pathways
Module
eoc_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:eoc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CE10_3511
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eoc01007]
    CE10_3511
Enzymes [BR:eoc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     CE10_3511
Amino acid related enzymes [BR:eoc01007]
 Aminotransferase (transaminase)
  Class II
   CE10_3511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Beta_elim_lyase Speriolin_C OKR_DC_1 Flg_hook
Motif
Other DBs
NCBI-ProteinID: AEQ14233
UniProt: A0A0E0VAJ3
Position
3581875..3583047
Genome map
AA seq 390 aa AA seqDB search
MGLYDKYARLAGERLQFSDNGLTPFGTCIDEVYSATEGRIGNKKVILAGTNNYLGLTFNH
DAIAEGQAALAAQGTGTTGSRMANGSYAPHLALEKEIAEFFNRPTAIVFSTGYTANLGVI
SALADHNAVVLLDADSHASIYDACSLGGAEIIRFRHNDAKDLERRMVRLGERAKEAIIIV
EGIYSMLGDVAPLAEIVDIKRRLGGYLIVDEAHSFGVLGATGRGLAEAVGVEDDVDIIVG
TFSKSLASIGGFAVGSEAMEVLRYGSRPYIFTASPSPSCIATVRSSLRTIATQPELRQKL
MDNANHLYDGLQKLGYELSSHISPVVPVIIGSKEEGLRIWRELISLGVYVNLILPPAEPA
GITLLRCSVNAAHSREQIDAIIQAFATLKQ
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggggctatacgataaatatgcgcgccttgctggcgagcgactgcaatttagtgacaac
gggttaacaccgtttggcacctgtattgatgaagtgtattccgccaccgaaggtcggatc
ggcaataaaaaagtgattctggccgggaccaataattatctcggtttaacctttaatcat
gatgccatcgccgaaggtcaggcagcgttagcggcccaaggcaccggcaccaccggttct
cgtatggcaaacggcagttatgcgccgcacctggcgttagagaaagagattgccgagttt
ttcaatcgccctaccgctatcgttttttcaaccggttataccgctaatttaggcgtcatc
agcgcacttgccgaccataacgccgtggtgttactggatgccgacagccacgccagtatt
tatgacgcctgttctctcggtggcgcagaaattattcgtttccgccataacgatgctaaa
gatctggaacggcgcatggttcgcctcggtgaacgggcgaaagaggcgattatcatcgtt
gagggcatctacagcatgctcggtgacgttgcgccgttagcggaaattgttgatatcaaa
cgtcgtctcggtggttatttgattgtcgatgaagcgcattcgtttggcgtgttaggcgca
acggggcgcggactggctgaagccgttggcgttgaagatgatgtggatattatcgttggt
actttcagtaaaagtctggcctcgattggcggttttgctgtcggttcggaagcgatggaa
gtgctgcgctacggcagccgcccgtatatttttaccgcctctccttctccgtcctgcatt
gcgaccgtgcgctcgtcgttaagaaccattgccacacaaccagagctgcggcaaaaactg
atggataacgccaaccatctgtatgacggtctgcaaaaactgggttatgagttaagttca
catattagcccggtagtgccagtaataatcggttcgaaagaggaaggtttacgcatctgg
cgcgagcttatttcgctgggcgtttatgtgaatcttatcctgccacctgccgagcctgca
ggcatcactctgctgcgctgtagcgtaaacgctgcccacagtcgtgagcaaatcgatgcc
atcattcaggcatttgctactctgaagcagtaa

DBGET integrated database retrieval system