KEGG   Endosymbiont of Sipalinus gigas: NARSGI1_00590Help
Entry
NARSGI1_00590     CDS       T06000                                 

Gene name
rluD
Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
eof  Endosymbiont of Sipalinus gigas
Brite
KEGG Orthology (KO) [BR:eof00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:eof03009]
    NARSGI1_00590 (rluD)
Enzymes [BR:eof01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     NARSGI1_00590 (rluD)
Ribosome biogenesis [BR:eof03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    NARSGI1_00590 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: BBA85211
UniProt: A0A2Z5T480
Position
complement(61103..61801)
Genome map
AA seq 232 aa AA seqDB search
MLNIIYEDKYIIIINKQNNLIVNNILYKKNKTLVDLLNEYYPNIVNVERNGIIHRLDKNT
TGLLVVAKTNMSYKFLINSFLKKKNIKEYITLVSGLLISGGNINSYIKRDFKNKMKMKVS
NNGKYSITHYRIIDKFNIFTLLKVILYTGRTHQIRVHMSYINHPIIGDFKYGKNISIFDK
SMNFIKKRNINFNRQALHSSKLIIQHPVSNKFMHFYSEIPKDMMDLIKILKK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatataatttatgaagataaatatattattattattaataaacaaaataattta
atagtaaataatatattatataaaaaaaataaaacattagttgatttattaaatgaatat
tatcctaatattgttaatgttgaaagaaatggaataatacatagattagataaaaatact
acaggattattagtagttgctaaaacaaatatgtcttataaatttttaataaattcattt
ttaaaaaaaaaaaatataaaagaatatataacattagtatcaggtttgctaatttccgga
ggaaatataaatagttatataaaaagagattttaaaaataaaatgaaaatgaaagtatct
aataacggaaaatattcaattacacattatagaataatagataaatttaatatttttact
ttgttaaaagttatattatataccggcagaactcatcaaataagagttcatatgtcatat
ataaatcatcctataataggtgactttaaatatggtaagaatatttctatatttgataaa
tcaatgaatttcataaaaaaaagaaatataaattttaatagacaagctttacattcatca
aaattaattatacaacatcctgtaagtaataaatttatgcatttttatagtgaaattccc
aaagatatgatggatttaataaaaatattaaaaaaataa

DBGET integrated database retrieval system