KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_0215Help
Entry
ECO103_0215       CDS       T01096                                 

Definition
(GenBank) IcmF-like protein
  KO
K11891  type VI secretion system protein ImpL
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eoh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECO103_0215
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eoh02044]
    ECO103_0215
Secretion system [BR:eoh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECO103_0215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related ImcF-related_N IcmF_C AAA_22 AAA_16 HAD
Motif
Other DBs
NCBI-ProteinID: BAI29091
UniProt: C8U1T3
Position
complement(242311..245835)
Genome map
AA seq 1174 aa AA seqDB search
MFRLPTPRLLSGLKSALRPAMPRFKVSAFWLLILAWIFLLVWIWWKGPTWTLYEEQWLKP
LANRWLATAAWGIIALMWLTVRVMKRLQQLEKQQKQQREEAIDPLSVELNAQQRYLDRWL
LRLQRHLDNRRFLWQLPWYMVIGPAGSGKTTLLREGFPSDIIYAPEGSRGAEQRLYLTPH
VGKQAVIFDIDGTLCAPADADILHRRLWEHTLGWLKEKRARQPLNGIILTLDLPDLLTAD
KRRREYLLQTLRSRLQDIRQHLHCQLPVYVVLTRLDLLQGFAALFQSLNRQDRDAILGVT
FTRRAHENDDWRTELNAFWQTWVDRMNLALPDLMVAQTHTRASLFSFSRQMQGSREPLVS
LLEGLLDGENMNVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAPYF
TRSLFPQALLAEPNLATESRDWLMRSRRRLTVFSATGGVAALLLITGWHHYYNGNYQSGI
TVLKQAKAFMDVPPPQGKDDYGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRIG
PYVEQTYLQLLEQRYLPSLFNGLVKAMNAAPPESEEKLAVLRVMRMLEDKSGRNNEVVKQ
YMAKRWSEKFHGQRDIQAQLMSHLDYALAHTDWHAERQAGDGDAISRWMPYDKPVVSAQK
ELSKLPVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQVFTSADDNKLVVPQFLTRYGL
QSYFVKQRDELVELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYISDYTATWRAGMDN
LNIRNFESIGQLTGALEQVISGDQPLQRALTVLRDNTQPGVFSEKLSAKERDEALAEPDY
QLLTRLGHEFAPENSTLAVQKDKESTMQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQL
RLDQNSSDPIFATRQMAKTLPAPLNRWVGRLADQAWHVVMVEAVHYMEVDWRDSVVKPFN
EQLANNYPFNPRSAQDASLDAFERFFKPDGILDTFYQQNLKLFIDNDLSLEDGDNSVIIR
EDIIAQLKTAQKIRDIFFSKQNGLGTSFAVETVSLSGNKRRSVLNLDGQLVDYSQGRNYT
AHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQFRLFGAGQLTGVQDGNFTVRFS
VDAGAMTYRVHTDTEDNPFSGGLFSQFGLSDTLY
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
gtgttcagattaccaacaccccgactactcagcggactcaaatcagccctgcgaccggcg
atgccccggtttaaagtctctgctttctggctgctgatactggcgtggatttttctgctg
gtgtggatctggtggaaaggcccgacgtggacgctgtatgaagaacagtggctcaaacca
ctggcgaaccgctggctggcaacggcggcgtgggggattattgccctgatgtggcttacc
gtccgggtgatgaagcgcctgcaacagcttgaaaaacagcaaaaacaacagcgcgaggaa
gccattgatccgctcagtgtggaactgaacgcccagcagcgttacctcgaccgctggctg
ctgcgcctgcaacgccatctcgacaaccgccgtttcctgtggcaattgccgtggtatatg
gtcatcggcccggcgggcagtggcaaaacgacactgctgcgcgaggggtttccgtcagac
attatttatgccccggagggctcgcgcggcgcagaacaacgcctgtaccttacgccccat
gtcggtaaacaggcggtgatctttgatatcgacggcacactctgcgctcccgctgatgcg
gatatcctgcatcgccgtctgtgggaacataccctcggctggctgaaggaaaagcgcgcg
cgccagccgctgaacgggattattctgacactcgatttacccgatctgctgaccgcagac
aagcgccgccgtgagtatctgctacagacgctgcgcagccgcttgcaggatatacgccag
catcttcactgccagctaccggtttacgtggtactgacccggcttgatttattgcagggt
tttgccgccctgttccagtccctgaacagacaggatcgtgatgcgattctgggtgtcacg
ttcacccgccgtgcccatgaaaatgatgactggcgaacagagttgaatgctttctggcag
acatgggtggatcgaatgaatctggcgttgccggatctgatggtcgctcagactcacacc
cgcgcgtctttattcagtttttcccgccagatgcagggaagccgtgaacccctggtgtca
ctgcttgaaggtctgcttgacggcgaaaatatgaacgtgatgctgcgtggtgtctatctc
acctcgtcactgcaacgcggccagatggatgacatctttacccagtccgccgcccgccag
taccggctgggcaataacccactggcgtcctggcccctggtggacaccgcgccttatttc
acccgcagcctgttcccgcaggcattactcgcagagcctaatctggcaacggagagccgt
gactggctgatgcgttcccgtcgccgcctgacggttttctctgccacaggcggcgtggcg
gcactgctgctcatcaccggctggcatcactattacaacggtaactatcagtccggcatc
accgtgcttaagcaggccaaagcctttatggacgtgccgcctccgcaggggaaagacgac
tacggcaacctgcaactgccgctgctgaacccggtacgcgatgccacactggcctatggc
gactggggcgaccgcagccgtctggccgatatgggactgtaccagggacgacgtatcggg
ccttatgtggaacagacctatctgcaactactagagcagcgttacctgccctcgctgttt
aacgggctggtcaaagcgatgaacgccgcgccgccggagagtgaggaaaaactcgccgtg
ctgcgcgtgatgcgaatgctggaggacaaaagcggacgcaataatgaggtagtgaagcag
tatatggcaaaacgctggagcgaaaagttccacggccagcgtgatatccaggcacaactg
atgtcccatcttgactacgcgctggctcatactgactggcatgcagagcgtcaggcgggc
gacggtgacgccatcagccgctggatgccatatgacaagcccgtggtatcagcacagaaa
gaactgagcaaactgcctgtctaccagcgggtttaccagagcctgaaaacgcgggcgctg
ggcgttctacctgctgacctcaatctgcgtgaccaggtagggccaacctttgaccaggtc
tttacatctgccgatgacaacaaactggttgttccacagtttcttacccgttacggcctg
caaagctattttgtaaaacagcgcgatgaactggttgaactgacggcaatggattcctgg
gtactcaacctcacccgcagtgtgaaatacagtgacgccgaccgcgcggaaatccagcgc
cagttgaccgagcagtatatcagcgactacaccgctacctggcgagccgggatggacaat
ctgaatatccgcaattttgagtccattggacaactgaccggggcgctggagcaggttatc
agcggcgaccagcctttgcagcgggcgctgactgtgttgcgtgacaacacacagccaggc
gtcttttctgaaaaactttctgccaaagaacgggatgaggctctggcagaaccggactac
cagttgctcacccgcctcgggcatgaatttgccccggaaaacagtactctggcagtacag
aaagacaaagaaagcacgatgcaggccgtgtatcagcaactcaccgagttgcaccgctat
ctgctggcaattcagaacgcgcctgtaccagggaaatcggcgctgaaagccgtgcagttg
cggcttgatcagaacagcagcgatccgatattcgccacccgccagatggcaaagacactg
cctgctccgctcaaccgctgggttggcagactggctgaccaggcctggcatgtggtgatg
gtggaggccgttcactatatggaagtggactggcgcgacagcgtggtgaaaccgtttaac
gagcaactggcaaataactatccgtttaatccgcgttctgcacaggatgcctcactggat
gccttcgaacgcttctttaaaccggatggcatactggataccttctaccagcagaacctg
aagctgtttatcgacaatgacctgagtctggaggatggcgataacagcgtcattattcgc
gaagatattattgcgcaactgaaaaccgcgcagaaaatccgtgacatcttcttcagtaaa
cagaacggtctgggaacatcctttgccgtggaaacggtatcgctctccggcaacaaacgc
cgcagtgtactgaaccttgacggccagttagtcgattacagccaggggcgcaactatacc
gcccatctggtctggcctaacaatatgcgcgaaggcaacgaaagcaaactgacgctcatc
ggcaccagcggcaacgcaccgcgcagtatcagcttcagcgggccgtgggcgcagttccgc
cttttcggggccggacaactgaccggagttcaggatggcaactttaccgtgcgctttagc
gtggacgctggcgcgatgacctaccgtgtgcataccgacactgaggataacccattcagc
ggtgggttattcagccagtttggtctgtcagacacactgtactga

DBGET integrated database retrieval system