KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_0222Help
Entry
ECO103_0222       CDS       T01096                                 

Definition
(GenBank) conserved predicted protein
  KO
K11894  type VI secretion system protein ImpI
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Brite
KEGG Orthology (KO) [BR:eoh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eoh02044]
    ECO103_0222
Secretion system [BR:eoh02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   ECO103_0222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHA
Motif
Other DBs
NCBI-ProteinID: BAI29098
Position
complement(253406..254686)
Genome map
AA seq 426 aa AA seqDB search
MPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHGPECHWSVQDRQQSIPAQAFTVI
LHDGTFCLRPQTAQLWLNQAKVTATSDLIQLRQGDEIQIGRLMVRVHLNRGDIPHYDEEM
ATPETIVTNRDMLTDTLLSTEGTPHYPGMTHRHQLADTVVNGFSADPLQALQSESLITTG
DPLSGIAAVRPSAPLSDPASNGGINTPFMDLPPIYASPGDRNDDVSAAEMAQRHLAVTPL
LRGLGGSLTMSNSDDADDFLEEAGRTLQAAIKGLLDLQQQRNSLSDKHLRPLEDNPLRLN
MDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEANRAAIVESLRVLLDAFSPQNL
LRRFVQYRRSHELRQPLDDAGAWQMYSHYYEELASDRQQGFEMLFNEVYAQVYDRVLREK
QREPEA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagagaaactacagacgctttcattgcaggtcattaacggcagtgagctggaa
agcggacgggcggcgcgctgtctgttcacacagcagggaaatgtcggccatggccccgaa
tgccactggtcggtacaggatcgtcagcagagcattccggcccaggcttttaccgttatc
ctgcacgatggcacattttgtctgcgcccgcagacggcacaactgtggctgaatcaggca
aaagtcacagcaacatcagacctaatacagttgcgccagggcgatgagatccagatcgga
cggctgatggtgagggttcatctgaaccggggagatattccccattacgatgaggaaatg
gccactcccgaaaccatcgttaccaatcgcgatatgctcacggataccctgctatcaacg
gagggtacgccacactatccgggaatgactcaccggcaccaacttgcagacaccgtggta
aacggtttttctgccgatccactccaggcacttcagtccgaaagcctgattaccacgggc
gatccgctttcaggcattgcggctgtccggccatcggcaccgctgtccgatccggcaagt
aatggggggatcaatactccgtttatggatctgccgcccatttatgccagccccggcgat
cgtaatgacgacgtctctgcggcagaaatggcgcaacgccaccttgcggtcaccccctta
ctgcgcggtcttggcggctcgcttaccatgagcaattccgacgatgcggatgattttctg
gaggaggccggacgaacgttacaggccgcaataaaaggtctgctcgatttgcagcagcag
cgtaacagcctctcagacaaacatttgcgcccgctggaagataacccgctgcgcctgaac
atggattacgccaccgcgctcgacgtaatgtttgccgaaggtaaaagcccggtacatctg
gcggctcccgccgccgtcagtgaaagcctgcgcaatgtccgccaccacgaagaagctaac
cgggcagcgattgtggagtcgcttcgtgtcctgctggatgctttctcaccacaaaatctg
ctgcgccgctttgtgcagtaccgccgcagccatgaactgcgccagccgctggatgatgcc
ggagcatggcaaatgtacagccattattacgaagaactggcctccgatcgccagcagggg
tttgagatgctgtttaacgaggtctacgcccaggtctatgaccgggtgcttcgtgaaaaa
cagcgggagccggaagcatga

DBGET integrated database retrieval system