KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_0226
Entry
ECO103_0226       CDS       T01096                                 

Definition
(GenBank) conserved predicted protein
  KO
K11900  type VI secretion system protein ImpC
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Brite
KEGG Orthology (KO) [BR:eoh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eoh02044]
    ECO103_0226
Secretion system [BR:eoh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECO103_0226
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: BAI29102
Position
complement(258031..259506)
AA seq 491 aa
MSLQEEELVSSHAGQPEQASSLLDQIMAQTRIQPGSEGYDVARQGVTAFIASILQSTASA
EPVNKLAVDSMIADIDERISRQMDVIIHAPAFQQVESFWRSLKTMVDRVDFRENIKVNVL
HVTKQELLEDFEFAPEIIQSGFYKHVYSSGFGQFGGEPIAAVLGAYEFKNTAPDMKLLQY
VSAVGAMAHAPFLSSVSPEFMGLNSWTELPNIKDLYAIFEGPAYTKWRALRDSEDSRYLG
LTAPRFLLRQPWSPADNPVKSFNYHEDVSQNHEDYLWGNTAWMLACNIADSFAKYRWCPN
IIGPQSGGAVKDLPVHLFETMGQIQAKIPTEVLVTDRREFELAEEGFITLTMRKDSDNAA
FFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLER
ELNTWIRQYVADQENPPADVRSRKPLRAARVEVMDVEGEPGWYQVALSVRPHFKFMGANF
ELSLVGRLDRE
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtctttacaggaagaggaactcgtttccagtcatgccgggcagcctgagcaggcatcg
tcgctgcttgatcaaatcatggcacagacccgtattcagcccggttcggaaggttatgac
gttgcccgccagggtgtgacagcctttattgccagcatcctgcaatccactgcatctgcc
gaaccggtcaataaactggccgtggacagcatgattgcagatattgatgaacgcatcagc
cgccagatggatgtcatcatccatgcgcctgcctttcagcaggtcgaatcgttctggcgc
tcactgaaaaccatggtggatcgcgttgatttccgtgaaaacatcaaggtcaacgtgctt
catgtcaccaagcaggaacttctggaagactttgagtttgcgccagaaattattcagtcc
ggattttataagcacgtttattcgtccggattcggacagtttggtggtgaacccatcgct
gccgtgctgggcgcttatgagttcaaaaataccgcacctgacatgaaactgctgcaatac
gtcagtgccgtgggcgcaatggcgcacgcaccgttcctgtcctccgtttccccggagttt
atggggctgaactcgtggaccgaactgcctaatatcaaagatctttatgccatctttgaa
ggtccggcctacaccaaatggcgcgccctgcgtgactcggaagattcgcgctatttaggg
cttactgcaccccgcttcctgcttcgccagccctggtcaccagcagataaccctgttaaa
agctttaactatcacgaagatgtcagccagaaccacgaagattatctgtggggtaatacg
gcctggatgctggcatgcaatatcgcagacagttttgccaaataccgctggtgtccaaac
attatcggcccgcaaagcggcggcgcggtgaaagatctgccggtgcatctgttcgaaacg
atggggcagattcaggccaaaatcccaaccgaggtgctggtcaccgatcgccgcgaattt
gaactggctgaagagggttttatcaccctgaccatgcgtaaagactctgataatgcagcc
tttttctctgcaaactcggtacaaaaaccgaagcactttccgggaaaagatgcagaaacc
aactataagctgggtacgcagcttccttatctcttcatcatcaaccggttagcgcactac
atcaaggtgttgcagcgtgaacaactggggtcatggaaagaaaggagcgacttagagagg
gagcttaatacctggatccgtcagtatgttgccgaccaggaaaacccgcctgcggacgtg
cgcagccgtaaacctctgcgcgcagccagagttgaggttatggatgtggaaggcgaaccc
ggctggtaccaggttgcgctaagcgtgaggcctcattttaaatttatgggggcaaatttt
gagctttccctggttggccggttagacagggagtaa

DBGET integrated database retrieval system