KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_0227
Entry
ECO103_0227       CDS       T01096                                 

Definition
(GenBank) conserved predicted protein
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
SSDB
Motif
Pfam: VipB
Other DBs
NCBI-ProteinID: BAI29103
Position
complement(259557..259781)
AA seq 74 aa
MTAHKNISETYHLSVADILQVVYQVCFSPSVEINQDGVAALITTLDRRISDLLDEIIHFC
EFQQSASHWQRVLH
NT seq 225 nt   +upstreamnt  +downstreamnt
atgacggcacacaaaaatatctccgagacataccacctctctgttgcagacattctgcag
gtggtttaccaggtatgtttcagcccgtccgttgaaatcaaccaggatggtgtggctgcg
ctgattacaacactggatcgccgtatcagtgatctattggatgagattatccatttttgt
gagtttcagcagagcgcgtcgcactggcagcgcgtacttcactga

DBGET integrated database retrieval system