KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_0716Help
Entry
ECO103_0716       CDS       T01096                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh00020  Citrate cycle (TCA cycle)
eoh00190  Oxidative phosphorylation
eoh00650  Butanoate metabolism
eoh01100  Metabolic pathways
eoh01110  Biosynthesis of secondary metabolites
eoh01120  Microbial metabolism in diverse environments
eoh01130  Biosynthesis of antibiotics
eoh01200  Carbon metabolism
Module
eoh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eoh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eoh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eoh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECO103_0716 (sdhD)
   00650 Butanoate metabolism
    ECO103_0716 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ECO103_0716 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: BAI29573
UniProt: C8U365
Structure
PDB: 

Position
788947..789294
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgctaccagt
ggcgagctgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggccttgcgcctgatgctgcaactggtgattgtcgttgct
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system