KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_1609Help
Entry
ECO103_1609       CDS       T01096                                 

Gene name
sra
Definition
(GenBank) 30S ribosomal subunit protein S22
  KO
K02972  stationary-phase-induced ribosome-associated protein
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Brite
KEGG Orthology (KO) [BR:eoh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:eoh03009]
    ECO103_1609 (sra)
Ribosome biogenesis [BR:eoh03009]
 Prokaryotic Type
  Other maturation factors
   ECO103_1609 (sra)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S22
Motif
Other DBs
NCBI-ProteinID: BAI30431
UniProt: C8U8F3
Position
complement(1703190..1703327)
Genome map
AA seq 45 aa AA seqDB search
MKSNRQARHILGLDHKISNQRKIVTEGDKSSVVNNPTGRKRPAEK
NT seq 138 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgaaccgtcaggcacgtcatattcttggactggaccataaaatttctaaccag
cgcaaaatagttaccgaaggtgacaaatccagcgtggtaaataatccaaccggcagaaaa
cgccccgctgaaaagtaa

DBGET integrated database retrieval system