KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_1619
Entry
ECO103_1619       CDS       T01096                                 
Symbol
gadC
Name
(GenBank) predicted glutamate:gamma-aminobutyric acid antiporter GadC
  KO
K20265  glutamate:GABA antiporter
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:eoh00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ECO103_1619 (gadC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eoh02000]
    ECO103_1619 (gadC)
Transporters [BR:eoh02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   ECO103_1619 (gadC)
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-ProteinID: BAI30440
Position
complement(1711656..1713191)
AA seq 511 aa
MATSVQTGKAKQLTLLGFFAITASMVMAVYEYPTFATSGFSLVFFLLLGGILWFIPVGLC
AAEMATVDGWEEGGVFAWVSNTLGPRWGFAAISFGYLQIAIGFIPMLYFVLGALSYILKW
PALNEDPITKTIAALIILWALALTQFGGTKYTARIAKVGFFAGILLPAFILIALAAIYLH
SGAPVAIEMDSKTFFPDFSKVGTLVVFVAFILSYMGVEASATHVNEMSNPGRDYPLAMLL
LMVAAICLSSVGGLSIAMVIPGNEINLSAGVMQTFTVLMSHVAPEIEWTVRVISALLLLG
VLAEIASWIVGPSRGMYVTAQKNLLPAAFAKMNKNGVPVTLVISQLVITSIALIILTNTG
GGNNMSFLIALALTVVIYLCAYFMLFIGYIVLVLKHPDLKRTFNIPGGKGVKLVVAIVGL
LTSIMAFIVSFLPPDNIQGDSTDMYVELLVVSFLVVLALPFILYAVHDRKGKANTGVTLE
PINSQNAPKGHFFLHPRARSPHYIVMNDKKH
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggctacatcagtacagacaggtaaagctaagcagctcacattactcggattctttgcc
ataacggcatcgatggtaatggctgtttatgaataccctaccttcgcaacatcgggcttt
tcattagtcttcttcctgctattaggcgggattttatggtttattcccgtgggactttgt
gctgcggaaatggccaccgtcgacggctgggaagaaggtggtgtcttcgcctgggtatca
aatactctggggccgagatggggatttgcagcgatctcatttggctatctgcaaatcgcc
attggttttattccgatgctctatttcgtgttaggggcactctcctacatcctgaaatgg
ccagcgctgaatgaagaccccattaccaaaactattgcagcactcatcattctttgggcg
ctggcattaacgcagtttggtggcacgaaatacacggcgcgaattgctaaagttggcttc
ttcgccggtatcctgttacctgcatttattttgatcgcattagcggctatttatctgcac
tccggtgcccccgttgctatcgaaatggattcgaagaccttcttccctgacttctctaaa
gtgggcacactggttgtatttgttgccttcattttgagttatatgggcgtagaagcttcc
gcaactcacgtcaatgaaatgagcaaccccgggcgcgactatccactggctatgttactg
ctgatggtggcggcaatctgcttaagctctgttggcggtttatctattgcgatggtcatt
ccgggtaatgaaatcaacctctccgcaggtgtaatgcaaacctttaccgttctgatgtcc
catgtggcaccggaaattgagtggacggttcgcgtgatctccgcactgctgttgctgggt
gttctggcggaaatcgcctcctggattgttggtccttctcgcgggatgtatgtcacagcg
cagaaaaacctgctgccagcggcattcgctaaaatgaacaaaaatggcgtaccggtaacg
ctggtcatttcgcagctggtgattacttctatcgcgttgatcatcctcaccaataccggt
ggcggtaacaacatgtccttcctgatcgcactggcgctgacggtggtgatttatctgtgt
gcttatttcatgctgtttattggctacatagtgttggttcttaaacatcctgacttaaaa
cgcacatttaatatccctggtggtaaaggggtgaaattggtcgtggcaattgtcggtctg
ctgacttcaattatggcgtttattgtttccttcctgccgccggataacatccagggtgat
tctaccgatatgtatgttgaattactggttgttagtttcctggtggtacttgccctgccc
tttattctctatgctgttcatgatcgtaaaggcaaagcgaataccggcgtcactctggag
ccaatcaacagtcagaacgcaccaaaaggtcacttcttcctgcacccgcgtgcacgttca
ccacactatattgtgatgaatgacaagaaacactaa

DBGET integrated database retrieval system