KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_3361Help
Entry
ECO103_3361       CDS       T01096                                 

Definition
(GenBank) predicted outer membrane lipoprotein
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpA
Motif
Other DBs
NCBI-ProteinID: BAI32108
Position
3419314..3420966
Genome map
AA seq 550 aa AA seqDB search
MRNTLKQAVVLWGMVLLLVLWSVFISPSGVLIWAGAAAIVLTVAALLIYRRRQAWTEMTG
DAGLLSLPPETYRQPVVLVCGDMSAHLFTDSPVRQVSEGLYLHVSDEEQLVAQAERLLTL
RPAWASQLAVAYTVMPGMYRDAAVLTGQLRRFAHSMATVRRRAGVNVPWLLWSGLSGSPL
PERANSPWFICTGGEIHVATSAETASPAQWLTQTSTQERSQQLCYLLKAESLMQWLNLNM
LAALNGPETKCPPLAMAVGLVPSLPAVDNNLWQLWITARTGLTTDIADTGTDATLPFPDA
LLRRLPRQSGFTPLRRACVTMLGITTVAGIAALCLSATENRQLLRHIGDDLHQFYAVPAE
EFITKARRLSVLKDDAIMLDGYYREGEPLRLGLGLYPGEQIRQPVLRAIRDWRPPEQKME
VTASLQAQTVRLDSMSLFDVGQARLKDGSTKVLVDALVNIRAKPGWLILVAGYTDATGDE
KSNQQLSLRRAEAVRNWMLQTSDIPATCFAVQGLGESQPAATNDTPQGRAVNRRVEISLV
PRSDACQDVK
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaacacgctgaaacaggccgtcgtgctgtggggaatggtgttactgctggtgctg
tggtcggtgtttatcagtccgtctggcgtactgatatgggccggggcggcggctatcgtt
ctgacggttgccgcgttgctgatttaccggcgcaggcaggcgtggacggagatgaccggc
gatgccgggttgttatcgctgccgccggaaacgtaccgacaaccggtagtgctggtctgt
ggcgatatgtcggcgcatctgttcactgacagcccggtccggcaggtttcagaagggctg
tatctgcatgtttctgatgaagaacagcttgtggcgcaggcggagcgattactgaccctt
cgcccggcgtgggcatcgcagcttgccgtggcatataccgtcatgcccggcatgtaccgg
gatgcggcggttctgaccggacaactgcgccggttcgcccacagtatggcgacagtgcgt
cgccgggcgggcgtaaacgtcccctggcttctctggagcgggctgtccggctcgccgttg
ccggagagagcgaattcaccgtggtttatctgtaccggcggcgaaattcatgtagcgacg
tctgctgaaaccgcctcccccgcgcagtggctcacgcagaccagcacacaggagcgcagc
cagcaactctgttacctgctgaaagccgaaagcctgatgcagtggctgaatcttaatatg
ctggcggcactgaacggcccggaaacgaaatgtccgccactggcgatggccgtggggctg
gtcccctcgttgcctgcggtggataacaacctgtggcagttgtggatcaccgccagaacc
ggcctgacgacggatatcgcggacaccggcacagacgccacgctgccgtttccggatgcc
ctgttacggcggttgccgcgtcagtcgggctttaccccgctgcgacgagcctgcgtgacc
atgctgggcatcaccaccgtggcgggtatcgccgcgctgtgtctgtcagccacggagaat
cgccagttattacggcatatcggtgatgatctgcaccagttttatgccgttccggcggag
gaatttatcaccaaagcccgtcgtctgtcggtgctgaaagacgatgcgatcatgctcgat
gggtattaccgggaaggagagccactgcgtctcggtctggggttataccccggtgaacaa
atccgccagccggtattacgcgccattcgtgactggcgtccgcctgagcaaaaaatggaa
gtgacagcctcgcttcaggcgcagaccgtgcgtcttgacagtatgtcgctgtttgacgtc
ggacaggcccgcctgaaagacggctcgacaaaagtgctggtggacgcactggtgaacatc
cgggcaaaaccgggctggctgatcctcgtggccggatataccgacgccaccggcgacgaa
aaaagcaatcagcagttatcgctgcgacgtgccgaagcggtgcgcaactggatgctgcag
accagcgacatcccggccacctgttttgccgtacagggactgggcgagagccagcctgcg
gcgaccaacgatacgccacagggccgggcagtcaaccggcgcgtcgaaatcagtcttgtt
ccgcgttctgacgcctgtcaggacgtgaaataa

DBGET integrated database retrieval system