KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_3364
Entry
ECO103_3364       CDS       T01096                                 

Definition
(GenBank) conserved predicted protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eoh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECO103_3364
Secretion system [BR:eoh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECO103_3364
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V Laminin_II Sarcoglycan_1
Other DBs
NCBI-ProteinID: BAI32111
Structure
PDB: 
2P5Z

Position
3424372..3426879
AA seq 835 aa
MGIQNFDHSHHKLKIRGLQSPVDVLTFEGREQLSTPFRYDIQFTSSDKAITPESVLMQDG
AFSLTAPPVQGMPVQTALRTLHGVITGFKHLSSSQDEARYEVRLEPRMALLARSRQNAIY
QNQTVPQIVEKILRERHQMRGQDFVFNLKSEYPSREQVMQYGEDDLTFISRLLSEVGIWF
RFATDARLKIEVVEFYDDQSGYERGLTLPLRHPSGLFDGETEAVWGLNTAYSVVEKSVTT
RDYNYRTATAEMMTEQHDATGGDNTTYGEAYHYADNFLQKGDKEAAESGAFYARIRHERY
LNEQAILQGQSTSSLLMPGLEIRVQGDDAPAVFRKGVLITGVTASAARDRSYELTFTAIP
YSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPGYES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKR
NVLRTPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDMWGA
VRAKKGIFISADAQDKAQGQVREMAPAMAILDGAQSQMQSLSTDAQTTNADPADLSSQIA
LLQQSVKDLTQAVILLSAPKGVAIASGEHLQLAASKNVIANAGNNADIGVVKNMFIGVGQ
ALSVFVRKAGIKLFANKGAVSVQAQNDLMELLAQKSIEITSTEDEIKITAKKKITLNGGG
SYIRLDACGIEAGTPGEYNVKAGYYGRKPKAKLTPELMAFPVIKSEDFNQSFILLDENTG
QPLINWPYELELESGLKMSGITDENGNTELISSDKEEVVNISVFEPDEFLDDDIN
NT seq 2508 nt   +upstreamnt  +downstreamnt
atgggtattcagaatttcgatcattcacaccacaagctcaaaattcgtggcctgcaaagt
ccggtggatgtgctgaccttcgaaggccgcgaacaactgagtaccccgttccgctacgac
attcagtttaccagcagcgataaagccatcacgccggagtcggtgctgatgcaggacggc
gcattcagcctgacggcaccgccggtacaggggatgccggtacagactgccctgcgcacc
ctgcacggcgtcatcaccggctttaaacacctgtcatcgtcacaggatgaagcccgttac
gaagtgcgccttgaaccccgaatggcgctgctggcccgcagccgccagaacgccatttac
cagaaccagacggtgccgcaaatagtcgaaaaaatcctgcgcgagcggcaccagatgcgc
ggtcaggacttcgtgtttaacctcaaaagcgaatacccgtcccgtgaacaggtgatgcag
tacggtgaggacgacctgacgtttatttcacgcctgctgtcggaagtgggtatctggttc
cgctttgccaccgacgcccggctgaaaattgaggttgtcgagttttacgacgaccagagc
ggctatgagcgcggactgacgctgccgcttcgccatccttcagggctgtttgatggtgaa
acggaagccgtatgggggctgaacaccgcatacagcgtggtggaaaaaagcgtcaccacg
cgggactacaactaccgcaccgccacagcagagatgatgacagagcagcatgacgccacc
gggggcgataacaccacctatggcgaagcctaccactacgctgacaacttcctgcaaaaa
ggcgacaaggaggcagcggaaagcggcgcgttttatgcccgtatccgtcacgaacgctac
ctgaatgaacaggccattctgcagggccagagcaccagttcactgctgatgccggggctg
gaaatcagggttcagggcgacgacgcgcctgcggtattccgcaagggcgtgctgattacc
ggcgtgacggccagcgcggcccgtgaccgcagctatgaactgacgttcacggcgataccc
tactcagaacgctacggctatcgcccggcgcttatcccccgccccgtaatggccggaaca
ctcccggcgcgggtcaccagtacggtgaagaacgacatctacgcccatatcgataaggac
gggcgctaccgggtcaatctcgactttgaccgtgatacgtggaagccgggctacgaaagc
ctgtgggtacgccagtcgcgcccgtatgcgggagacacctacggcctgcacctgccgctg
ctggcgggaacggaagtcagcatcgcctttgaggaaggcaacccggaccgaccgtatatc
gccggggtaaaacacgactcggcacacaccgaccatgtgaccattcagaactacaagcgc
aacgtgctgcgcaccccggcgaacaacaaaatccgcctcgatgatgagcgcggcaaagag
catatcaaggtcagtaccgagtacggcggcaagagccagttgaatctgggtcatctggtg
gatgccggaaaacaacagcgcggggaaggctttgaactgcgtaccgatatgtggggcgcg
gtgcgggcgaagaaagggatttttatcagcgccgatgcgcaggataaggcgcaggggcag
gtgcgcgaaatggctccggcgatggcaatactggatggcgcacagtcacagatgcagtcg
ctgtccactgatgcgcagacgacgaatgccgatccggcagatctgtcatcgcagatagcg
ctgttgcagcaaagtgtaaaagatctgacgcaggccgtgatcctgctaagtgcacccaag
ggcgtggcgatcgccagcggcgagcacctgcaactggcggcgtcgaagaatgtgatagcg
aacgcaggcaacaacgcagatatcggcgtagtaaaaaatatgtttatcggtgtgggtcag
gcgctgagcgtgtttgtgcgtaaagcgggcatcaagctgtttgccaataaaggggcggtc
tcggtacaggcacagaacgatctgatggaactgttggcacagaaatcgatagagatcacc
agtacggaagatgagatcaagatcaccgcgaagaagaaaatcacccttaacggcggtggc
agctacatccggctggatgcctgcgggatagaagcgggaacgccgggagaatataacgtt
aaggccggatattacgggcgtaaaccaaaggcgaagctgacgccggagctgatggcattt
ccggtgattaagtctgaggattttaatcagagctttattttgctggatgaaaatactggg
caaccacttattaattggccctatgaactagaactggaaagtgggctaaaaatgagtggg
attactgatgaaaatggaaatacagaactaatatcctctgataaggaggaggtcgttaat
attagtgtgtttgaacccgatgagtttttagacgatgacattaattaa

DBGET integrated database retrieval system