KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_3369Help
Entry
ECO103_3369       CDS       T01096                                 

Definition
(GenBank) conserved predicted protein
  KO
K11910  type VI secretion system protein VasJ
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Brite
KEGG Orthology (KO) [BR:eoh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eoh02044]
    ECO103_3369
Secretion system [BR:eoh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECO103_3369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasJ ImpA_N
Motif
Other DBs
NCBI-ProteinID: BAI32116
Position
3432715..3434325
Genome map
AA seq 536 aa AA seqDB search
MSELLQKLTRSCFVDRDALDVARTQAALWQTWLLPVTANTPVGEDPGYHDDFLRIRDEMN
KLSGADTDLICQLAESLLLTQAKDVRIATYYIWARLHRDGERGLAEGLALLTGLVERFGT
QLLPSRPASRKMALEWLAGEKMLDSLARYPEVAKEDFANIVAALSQLTVSFTAWPEDQHS
PSLMLLINALESRLAQSGGMNAVVPQNSSSVPAPSSPVDAPQVQTITSGRDLLDQAKVLA
RYLNEQPQGWLSAHRLMKTLRWDTVHELPPDVDGKTRLAPPRTESRNQLKRLYAQQNWTE
LLEQADLMFSTGVSHFWLDIQWYLHQALTKAGAPWDRWTAVIRQDLALLLERLPGLENLA
WNDDTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEALEMADSQGV
EAALGWIQTRPGITTARQRLLLRLLMARVAEQYGKNEMALLLLEELDTAAQGLTLTQWEP
DLLFEVKARQLKLLRLRAHRYADKALLNRKMEILLGTLVTIDPVRAAVLCDTQHKD
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactgttgcaaaagctgacccgtagctgttttgtcgaccgggatgcactggat
gtggcgcgaacacaggcagcgctgtggcagacatggctgctgccggtgacggcaaatacg
ccggtcggggaagaccccggctaccacgacgatttcctgcgtatccgcgacgagatgaac
aaactttccggcgcggatacggacctcatctgccagcttgccgaatccctgctgctgacg
caggcaaaagacgtgcgcatcgccacttactacatctgggcgcgactgcaccgcgacggt
gagcgcggactggctgaggggctggcgctactgaccggactggtggaacgcttcggtacg
caactgctgccctcgcgaccggccagccggaaaatggcgctggagtggctggcaggggaa
aagatgctcgacagtcttgcccgctacccggaagtggcaaaagaggattttgcgaacatt
gttgctgccctcagtcagttgacggtttccttcactgcatggcccgaagaccagcattcc
ccctccctgatgctgctgattaacgcgctggaatcacgtctggcgcagtcgggcgggatg
aacgcggtggtgccgcaaaacagcagcagcgttcctgcaccgtcatccccggtggatgcg
ccacaggtacagaccatcacctccgggcgtgacctgctcgaccaggcgaaagtgctggcc
cgttatctgaacgaacagccgcagggctggctttcggcgcaccggctgatgaaaaccctg
cgctgggacacagtgcatgaactgccgccggatgtggacggcaaaacccggctggccccg
ccgcgcaccgagtcacgcaaccagcttaagcggctgtatgcgcagcagaactggacggaa
ctgctggagcaggccgacctgatgttcagcaccggcgtcagccatttctggctggatatc
cagtggtatctgcatcaggcgctgactaaggcgggcgcaccgtgggacaggtggacagcc
gttatccgtcaggacctggcgctgctgctggaacgtctgccagggctggaaaatctggca
tggaacgacgacacaccgttcgccgacgaggtgacgcgcaactggatagcgcagcaggtc
atgatgcgggaagacggcgcatggcttgcagggaaagccgctgtaccgacagacgacgcc
acaaatgacgtactggcgctggagccggaagcactggagatggcagacagtcagggcgtg
gaagcggctctgggctggatacagacccgtccgggcatcaccacggcacgccagcgcctg
ttattgcgactgctgatggcgcgggtggcggaacagtacggtaaaaacgaaatggcgctc
ctgctgctggaagaactggataccgccgcacaggggctgacactgacgcagtgggagccg
gacctgctgtttgaggtaaaagcccgacaactgaaactgctgcgcctgcgggcgcaccgc
tatgcggataaagccctgctgaaccgaaaaatggaaatcctgctgggaacgctggtgaca
atcgatccggtacgggcagcggtattgtgtgatacgcaacataaggactga

DBGET integrated database retrieval system