KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_3373
Entry
ECO103_3373       CDS       T01096                                 

Definition
(GenBank) conserved predicted protein
  KO
K11906  type VI secretion system protein VasD
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eoh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECO103_3373
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eoh02044]
    ECO103_3373
Secretion system [BR:eoh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECO103_3373
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: BAI32120
Position
3439508..3440044
AA seq 178 aa
MFPIRFKRPALLCMAMLTVVLSGCGLIQKVVDESKSVASAVFYKQIKILHLDFFSRSALN
TDAEDTPLSTMVHVWQLKTREDFDKADYDTLFMQEEKTLEKDVLAKHTVWVKPEGTASLN
VPLDKETQFVAIIGQFYHPDEKSDSWRLVIKRDELEADKPRSIELMRSDLRLLPLKDK
NT seq 537 nt   +upstreamnt  +downstreamnt
atgtttcctattcgttttaaacgtccggcgctgctctgtatggcgatgctgacggttgtt
ctgagcggctgcgggctgattcagaaagtggtggatgaatcgaaaagcgtggcctcagcc
gttttctacaagcaaatcaaaatactgcatctcgatttcttctcccgaagtgccctgaat
acggatgcggaagatacgccgctttccacgatggtgcatgtctggcaactgaaaacccgc
gaagattttgacaaggcggattatgacaccctgtttatgcaggaagagaagacgctggag
aaggacgtactggcaaaacacaccgtctgggtaaaaccggaaggcacggcatccctgaat
gtgccgctggataaagagacgcagtttgtcgccattattgggcagttttatcaccctgat
gaaaaaagcgacagctggcgtctggtgatcaaaagggacgaactggaggccgacaagccg
cgctcgattgaactgatgagaagcgacctgcgactgctgcctctcaaggataaataa

DBGET integrated database retrieval system