KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_4342Help
Entry
ECO103_4342       CDS       T01096                                 

Gene name
pldA
Definition
(GenBank) outer membrane phospholipase A PldA
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh00564  Glycerophospholipid metabolism
eoh00565  Ether lipid metabolism
eoh00590  Arachidonic acid metabolism
eoh00592  alpha-Linolenic acid metabolism
eoh01100  Metabolic pathways
eoh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eoh00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECO103_4342 (pldA)
   00565 Ether lipid metabolism
    ECO103_4342 (pldA)
   00590 Arachidonic acid metabolism
    ECO103_4342 (pldA)
   00591 Linoleic acid metabolism
    ECO103_4342 (pldA)
   00592 alpha-Linolenic acid metabolism
    ECO103_4342 (pldA)
Enzymes [BR:eoh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     ECO103_4342 (pldA)
    3.1.1.32  phospholipase A1
     ECO103_4342 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: BAI33047
UniProt: C8TYN5
Structure
PDB: 

Position
complement(4453465..4454334)
Genome map
AA seq 289 aa AA seqDB search
MRTLQGWLLPVFMLPMAVYAQEATVKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYL
IYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL
SNSEESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT
RLMAENGNWLVEVKPWYVVGNTDDNPDITKYMGYYQLKIGYHLGDAVLSAKGQYNWNTGY
GGAELGLSYPITKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDLF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcggactctgcagggctggttgttgccggtgtttatgttgcctatggcagtatatgca
caagaggcaacggtgaaagaggtgcatgacgcgccagcggtgcgtggcagtattatcgcc
aatatgctgcaggagcatgacaatccgttcacgctctatccttatgacaccaactacctc
atttacacccaaaccagcgatctgaataaagaagcgattgccagttacgactgggcggaa
aatgcgcgtaaggatgaagtaaagtttcagttgagcctggcatttccgctgtggcgtggg
attttaggcccgaactcggtgttgggtgcgtcttatacgcaaaaatcctggtggcaactg
tccaatagcgaagagtcttcaccgtttcgtgaaaccaactacgaaccgcaattgttcctc
ggttttgccaccgattaccgttttgcaggttggacgctgcgcgatgtggagatggggtat
aaccacgactctaacgggcgttccgacccgacctcccgcagctggaaccgcctttatact
cgcctgatggcagaaaacggtaactggctggtagaagtgaagccgtggtatgtggtgggt
aatactgacgataacccggatatcaccaaatatatgggttactaccagcttaaaatcggc
tatcacctcggtgatgcggtgctcagtgcgaaaggacagtacaactggaacaccggctac
ggcggcgcggagttaggcttaagttacccgatcaccaaacatgtgcgcctttatactcag
gtttacagcggctatggcgaatcgctcatcgactataacttcaaccagacccgtgtcggt
gtgggggttatgctaaacgatttgttttga

DBGET integrated database retrieval system