KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_0696Help
Entry
ECO111_0696       CDS       T01097                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00520  Amino sugar and nucleotide sugar metabolism
eoi01100  Metabolic pathways
eoi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:eoi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ECO111_0696 (nagA)
Enzymes [BR:eoi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     ECO111_0696 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: BAI34665
UniProt: C8UJY2
Structure
PDB: 

Position
complement(748531..749679)
Genome map
AA seq 382 aa AA seqDB search
MYALTQGRIFTGHEFLDDHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQL
NGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAK
HPNQALGLHLEGPWLNLVKKGTHNPNFVRKPDAALVDFLCENADVITKVTLAPEMVPAEV
ISKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLYNAMPYITGREPGLAGAILDEAD
IYCGIIADGLHVDYANIRNAKRLKGDKLCLVTDATAPAGANIEQFIFAGKTIYYRNGLCV
DENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANL
TAFTPDFKITKTIVNGNEVVTQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcattaacccagggccggatctttaccggccacgaatttcttgatgaccacgcg
gttgttatcgctgatggcctgattaaaagcgtctgtccggtagcggaactgccgccagag
atcgaacaacgttcactgaacggggccattctctcccccggttttatcgatgtgcagtta
aacggctgcggcggcgtacagtttaacgacaccgctgaagcggtcagcgtggaaacgctg
gaaatcatgcagaaagccaatgagaaatcaggctgtactaactatctgccgacgcttatc
accaccagcgatgagctgatgaaacagggcgtgcgcgttatgcgcgagtacctggcaaaa
catccgaatcaggcgttaggtctgcatctggaaggtccgtggctgaatctggtaaaaaaa
ggcacccataatccgaattttgtgcgtaagcctgatgccgcgctggtcgatttcctgtgt
gaaaacgccgacgtcattaccaaagtgaccctggcaccggaaatggttcctgcggaagtc
atcagcaaactggcaaatgccgggattgtggtttctgccggtcactccaacgcgacgttg
aaagaagcaaaagccggtttccgcgcggggattacctttgccacccatctgtacaacgcg
atgccgtatattaccggtcgtgaaccgggcctggcgggcgcgatcctcgacgaagctgac
atttattgcggtattattgctgatggcctgcatgttgattacgccaacattcgtaacgct
aaacgtctgaaaggcgacaaactgtgtctggttaccgacgccaccgcgccagcaggtgcc
aacattgaacagttcatttttgcgggtaaaacaatatactaccgtaacggactttgtgtg
gatgagaacggtacgttaagcggttcatccttaaccatgattgaaggcgtgcgtaatctg
gtcgaacattgcggtatcgcactggatgaagtgctgcgtatggcgacgctctatccggcg
cgtgcgattggcgttgagaaacgtctcggcacactcgccgcaggtaaagtagccaacctg
accgcattcacacctgattttaaaatcaccaagaccatcgttaacggtaacgaggtcgta
actcaataa

DBGET integrated database retrieval system