KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_0939Help
Entry
ECO111_0939       CDS       T01097                                 

Gene name
ltaE
Definition
(GenBank) L-allo-threonine aldolase, PLP-dependent
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00260  Glycine, serine and threonine metabolism
eoi01100  Metabolic pathways
eoi01110  Biosynthesis of secondary metabolites
eoi01120  Microbial metabolism in diverse environments
eoi01130  Biosynthesis of antibiotics
eoi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eoi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECO111_0939 (ltaE)
Enzymes [BR:eoi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     ECO111_0939 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 CheD
Motif
Other DBs
NCBI-ProteinID: BAI34894
UniProt: C8UL94
Structure
PDB: 

Position
complement(997173..998174)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQ
ANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKI
KPDDIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRERNLALHVDGARIFNAVVAYGCE
LKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMAGGGMRQSGILAAAGMY
ALKNNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVL
INASPIVRLVTHLDVSREQLAEVAAHWRAFLAR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgcagtgataccgttacccgaccgagccgcgccatgctcgaagcgatg
atggccgccccggttggggacgacgtttacggagacgaccctaccgttaatgctctgcag
gactatgcagcagagctttccggtaaagaagccgccatttttctgcctaccggcactcag
gccaacctggtcgctctgctcagtcactgcgaacgtggcgaagagtatattgtcggtcag
gccgcgcataactatctgtttgaagccggtggcgcagcggtgctgggcagtattcagccg
caacccatcgacgcggctgccgacggcacgctaccgctggataaagtggcgatgaaaatc
aaacccgacgatatccatttcgcccgcaccaaattactcagtctggaaaacacccacaac
ggcaaagtgctgccgcgtgaatacctgaaagaagcatgggaatttacccgcgagcgcaat
ctggcgctgcatgttgacggtgcgcgcatctttaatgccgtggtggcttacggctgcgaa
ctgaaagagatcacgcaatattgtgattcgttcaccatttgcctgtcgaaaggtcttggg
acgccagtcggttcattactcgtcggtaatcgtgattacattaaacgtgccatccgctgg
cggaaaatggccggtggcgggatgcgtcagtccgggattctggctgccgccgggatgtat
gccctgaaaaataacgtcgcacggttgcaggaagatcacgacaacgccgcctggatggcg
gagcaactgcgtgaagcaggcgcggatgtgatgcgtcaggacactaatatgctgtttgtt
cgcgtcggggaagaaaatgctgccgcgttaggcgaatacatgaaagcgagaaacgtgctg
attaacgcctcgccgattgtccgcctggtgacgcatcttgacgtctcgcgcgaacaactg
gcggaagtcgccgcccactggcgcgcattcctggcgcgttaa

DBGET integrated database retrieval system