KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_1024
Entry
ECO111_1024       CDS       T01097                                 

Gene name
ycbG
Definition
(GenBank) conserved predicted protein
  KO
K09911  uncharacterized protein
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Brite
KEGG Orthology (KO) [BR:eoi00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ECO111_1024 (ycbG)
SSDB
Motif
Pfam: MatP MatP_C RHH_4 TMF_TATA_bd
Other DBs
NCBI-ProteinID: BAI34979
UniProt: C8ULH9
Structure
PDB: 
4D8J

Position
1107642..1108094
AA seq 150 aa
MKYQQLENLESGWKWKYLVKKHREGELITRYIEASAAQEAVDVLLSLENEPVLVNGWIDK
HMNPELVNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFIVWQRLAGLAQRRGKTLSETIV
QLIEDAENKEKYANKMSSLKQDLQALLGKE
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaaatatcaacaacttgaaaatcttgaaagcggttggaaatggaagtatctggtgaag
aagcatcgcgaaggggagttaatcacccgttacatagaagccagtgccgcccaggaagcc
gtcgatgtgttgctctcgctcgaaaatgaacccgtgctggtaaatggctggattgacaag
catatgaatccggaactggtcaatcgcatgaagcaaaccattcgggcaagacgaaagcgc
cattttaatgcggaacaccagcatacgcgcaaaaaatcgatcgatctggaatttattgtc
tggcaacgtctggctggtcttgcgcagcgtcgcggtaaaacgctttctgaaacgattgtt
cagctgattgaagatgcggaaaacaaagagaaatacgcgaataaaatgtcttctctgaag
caggatctgcaggcattgctgggtaaggaataa

DBGET integrated database retrieval system