KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_2360Help
Entry
ECO111_2360       CDS       T01097                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00030  Pentose phosphate pathway
eoi00480  Glutathione metabolism
eoi01100  Metabolic pathways
eoi01110  Biosynthesis of secondary metabolites
eoi01120  Microbial metabolism in diverse environments
eoi01130  Biosynthesis of antibiotics
eoi01200  Carbon metabolism
Module
eoi_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
eoi_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
eoi_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:eoi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECO111_2360 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ECO111_2360 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eoi04147]
    ECO111_2360 (zwf)
Enzymes [BR:eoi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     ECO111_2360 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     ECO111_2360 (zwf)
Exosome [BR:eoi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ECO111_2360 (zwf)
  Exosomal proteins of colorectal cancer cells
   ECO111_2360 (zwf)
  Exosomal proteins of bladder cancer cells
   ECO111_2360 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: BAI36224
UniProt: C8UBV2
Position
complement(2357344..2358819)
Genome map
AA seq 491 aa AA seqDB search
MAVTQTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGQLNPDTRIIGVGRADWDKAAYTK
VVREALETFMKETIDEGLWDTLSARLDFCNLDVNDTAAFSRLGVMLDQKNRITINYFAMP
PSTFGAICKGLGEAKLNAKPARVVMEKPLGTSLATSQEINDQVGEYFEECQVYRIDHYLG
KETVLNLLALRFANSLFVNNWDNRTIDHVEITVAEEVGIEGRWGYFDKAGQMRDMIQNHL
LQILCMIAMSPPSDLSADSIRDEKVKVLKSLRRIDRSNVREKTVRGQYTAGFAQGKKVPG
YLEEEGANKSSNTETFVAIRVDIDNWRWAGVPFYLRTGKRLPTKCSEVVVYFKTPELNLF
KESWQDLPQNKLTIRLQPDEGVDIQVLNKVPGLDHKHNLQITKLDLSYSETFNQTHLADA
YERLLLETMRGIQALFVRRDEVEEAWKWVDSITEAWAMDNDAPKPYQAGTWGPVASVAMI
TRDGRSWNEFE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaacgcaaacagcccaggcctgtgacctggtcattttcggcgcgaaaggcgac
cttgcgcgtcgtaaattgctgccttccctgtatcaactggaaaaagccggtcagctcaac
ccggacacccggattatcggcgtagggcgtgctgactgggataaagcggcatataccaaa
gttgtccgcgaggcgctcgaaactttcatgaaagaaaccattgatgaaggtttatgggac
accctgagtgcacgtctggatttttgtaatctcgatgtcaatgacactgctgcattcagc
cgtctcggcgtgatgctggatcaaaaaaatcgtatcaccattaactactttgccatgccg
cccagcacttttggcgcaatttgcaaagggcttggcgaggctaaactgaatgctaaaccg
gcacgcgtagtcatggagaaaccgctggggacgtcgctggcgacctcgcaggaaatcaat
gatcaggttggcgaatacttcgaggagtgccaggtttaccgtatcgaccactatcttggt
aaagaaacggtgctgaacctgttggcgctgcgttttgctaactccctgtttgtgaataac
tgggacaatcgcaccattgatcatgttgagattaccgtggcagaagaagtggggatcgaa
gggcgctggggctattttgataaagccggtcagatgcgcgatatgatccaaaaccacctg
ctgcaaattctctgcatgattgcgatgtctccgccgtctgacctgagcgcagacagcatc
cgcgatgaaaaagtgaaagtactgaagtctctgcgccgcatcgaccgctccaacgtacgc
gaaaaaaccgtacgcgggcaatatactgcgggcttcgcccagggcaaaaaagtgccggga
tatctggaagaagagggcgcgaacaagagcagcaatacagaaaccttcgtagcgatccgc
gtcgacattgataactggcgctgggccggtgtgccattctacctgcgtactggtaaacgt
ctgccgaccaaatgttctgaagtcgtggtctatttcaaaacacctgaactgaatctgttt
aaagaatcgtggcaggatctgccgcagaataaactgactatccgtctgcaacctgatgaa
ggcgtggatatccaggtactgaataaagttcctggccttgaccacaaacataacctgcaa
atcaccaagctggatctgagctattcagaaacctttaatcagacgcatctggcggatgcc
tatgaacgtttgctgctggaaaccatgcgtggtattcaggcactgtttgttcgtcgcgac
gaagtggaagaagcctggaaatgggtagactccattactgaggcgtgggcgatggacaat
gatgcgccgaaaccgtatcaggccggaacctggggacccgttgcctcggtggcgatgatt
acccgtgatggtcgttcctggaatgagtttgagtaa

DBGET integrated database retrieval system