KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_2360
Entry
ECO111_2360       CDS       T01097                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00030  Pentose phosphate pathway
eoi00480  Glutathione metabolism
eoi01100  Metabolic pathways
eoi01110  Biosynthesis of secondary metabolites
eoi01120  Microbial metabolism in diverse environments
eoi01200  Carbon metabolism
Module
eoi_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
eoi_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
eoi_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:eoi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECO111_2360 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ECO111_2360 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eoi04147]
    ECO111_2360 (zwf)
Enzymes [BR:eoi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     ECO111_2360 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     ECO111_2360 (zwf)
Exosome [BR:eoi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ECO111_2360 (zwf)
  Exosomal proteins of colorectal cancer cells
   ECO111_2360 (zwf)
  Exosomal proteins of bladder cancer cells
   ECO111_2360 (zwf)
SSDB
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Other DBs
NCBI-ProteinID: BAI36224
UniProt: C8UBV2
Position
complement(2357344..2358819)
AA seq 491 aa
MAVTQTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGQLNPDTRIIGVGRADWDKAAYTK
VVREALETFMKETIDEGLWDTLSARLDFCNLDVNDTAAFSRLGVMLDQKNRITINYFAMP
PSTFGAICKGLGEAKLNAKPARVVMEKPLGTSLATSQEINDQVGEYFEECQVYRIDHYLG
KETVLNLLALRFANSLFVNNWDNRTIDHVEITVAEEVGIEGRWGYFDKAGQMRDMIQNHL
LQILCMIAMSPPSDLSADSIRDEKVKVLKSLRRIDRSNVREKTVRGQYTAGFAQGKKVPG
YLEEEGANKSSNTETFVAIRVDIDNWRWAGVPFYLRTGKRLPTKCSEVVVYFKTPELNLF
KESWQDLPQNKLTIRLQPDEGVDIQVLNKVPGLDHKHNLQITKLDLSYSETFNQTHLADA
YERLLLETMRGIQALFVRRDEVEEAWKWVDSITEAWAMDNDAPKPYQAGTWGPVASVAMI
TRDGRSWNEFE
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggcggtaacgcaaacagcccaggcctgtgacctggtcattttcggcgcgaaaggcgac
cttgcgcgtcgtaaattgctgccttccctgtatcaactggaaaaagccggtcagctcaac
ccggacacccggattatcggcgtagggcgtgctgactgggataaagcggcatataccaaa
gttgtccgcgaggcgctcgaaactttcatgaaagaaaccattgatgaaggtttatgggac
accctgagtgcacgtctggatttttgtaatctcgatgtcaatgacactgctgcattcagc
cgtctcggcgtgatgctggatcaaaaaaatcgtatcaccattaactactttgccatgccg
cccagcacttttggcgcaatttgcaaagggcttggcgaggctaaactgaatgctaaaccg
gcacgcgtagtcatggagaaaccgctggggacgtcgctggcgacctcgcaggaaatcaat
gatcaggttggcgaatacttcgaggagtgccaggtttaccgtatcgaccactatcttggt
aaagaaacggtgctgaacctgttggcgctgcgttttgctaactccctgtttgtgaataac
tgggacaatcgcaccattgatcatgttgagattaccgtggcagaagaagtggggatcgaa
gggcgctggggctattttgataaagccggtcagatgcgcgatatgatccaaaaccacctg
ctgcaaattctctgcatgattgcgatgtctccgccgtctgacctgagcgcagacagcatc
cgcgatgaaaaagtgaaagtactgaagtctctgcgccgcatcgaccgctccaacgtacgc
gaaaaaaccgtacgcgggcaatatactgcgggcttcgcccagggcaaaaaagtgccggga
tatctggaagaagagggcgcgaacaagagcagcaatacagaaaccttcgtagcgatccgc
gtcgacattgataactggcgctgggccggtgtgccattctacctgcgtactggtaaacgt
ctgccgaccaaatgttctgaagtcgtggtctatttcaaaacacctgaactgaatctgttt
aaagaatcgtggcaggatctgccgcagaataaactgactatccgtctgcaacctgatgaa
ggcgtggatatccaggtactgaataaagttcctggccttgaccacaaacataacctgcaa
atcaccaagctggatctgagctattcagaaacctttaatcagacgcatctggcggatgcc
tatgaacgtttgctgctggaaaccatgcgtggtattcaggcactgtttgttcgtcgcgac
gaagtggaagaagcctggaaatgggtagactccattactgaggcgtgggcgatggacaat
gatgcgccgaaaccgtatcaggccggaacctggggacccgttgcctcggtggcgatgatt
acccgtgatggtcgttcctggaatgagtttgagtaa

DBGET integrated database retrieval system