KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_2767Help
Entry
ECO111_2767       CDS       T01097                                 

Gene name
galF
Definition
(GenBank) predicted subunit with GalU
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00040  Pentose and glucuronate interconversions
eoi00052  Galactose metabolism
eoi00500  Starch and sucrose metabolism
eoi00520  Amino sugar and nucleotide sugar metabolism
eoi01100  Metabolic pathways
eoi01130  Biosynthesis of antibiotics
Module
eoi_M00362  Nucleotide sugar biosynthesis, prokaryotes
eoi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eoi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECO111_2767 (galF)
   00052 Galactose metabolism
    ECO111_2767 (galF)
   00500 Starch and sucrose metabolism
    ECO111_2767 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    ECO111_2767 (galF)
Enzymes [BR:eoi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECO111_2767 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 EFP_N
Motif
Other DBs
NCBI-ProteinID: BAI36613
UniProt: C8UCZ1
Position
complement(2693671..2694564)
Genome map
AA seq 297 aa AA seqDB search
MINLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQAQLLGLGHSILCARPI
VGDNPFVVVLPDVVLDTASADPLRYNLAAMVARFNETGRSQVLAKRMDDDLSEYSVIQTK
EPLDNEGKVSRIVEFIEKPDQPQTLDSDLMAVGRYVLSADIWAELEKTAPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKSIKKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgattaatttgaaagcagttattccggtagcaggtctggggatgcacatgttgcctgcc
acgaaggcaatccctaaagagatgctgccgatcgtagacaagccgatgattcagtacatt
gtcgacgaaattgtagctgccggtatcaaagaaatcgttctggtgactcatgcgtctaag
aacgcggttgagaaccacttcgacacctcttacgaactcgaatcactccttgagcagcgt
gttaagcgccagcttttagccgaggtacagtctatctgtcctcctggcgtgactattatg
aacgttcgtcaggctcagttactgggtctgggtcattccattctttgtgctcgcccgatt
gttggggataacccgtttgtcgtcgtattgcctgacgtcgttctggatacagcgagtgcg
gacccgttgcgttataacctggctgccatggttgcccgttttaatgaaaccgggcgcagt
caggtgctggctaaacgcatggatgatgatctgtccgaatactctgttattcagaccaaa
gagcctttggacaacgaaggcaaagtcagccgtatcgttgaattcattgaaaaacccgat
cagccacaaacgcttgattccgatctgatggccgtagggcgctacgtgctttctgctgat
atctgggctgagttggaaaaaactgctccaggtgcctggggacgtattcaactgactgat
gctattgcagagttggctaaaaaacagtctgttgatgccatgctgatgaccggcgacagc
tacgactgcggtaagaagatgggctatatgcaggcattcgttaagtatgggctgcgcaac
cttaaagaaggggcgaagttccgtaagagcatcaagaagctactgagtgagtag

DBGET integrated database retrieval system