KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_3125Help
Entry
ECO111_3125       CDS       T01097                                 

Gene name
glk
Definition
(GenBank) glucokinase Glk
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00010  Glycolysis / Gluconeogenesis
eoi00052  Galactose metabolism
eoi00500  Starch and sucrose metabolism
eoi00520  Amino sugar and nucleotide sugar metabolism
eoi00521  Streptomycin biosynthesis
eoi01100  Metabolic pathways
eoi01110  Biosynthesis of secondary metabolites
eoi01120  Microbial metabolism in diverse environments
eoi01130  Biosynthesis of antibiotics
eoi01200  Carbon metabolism
Module
eoi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eoi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eoi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECO111_3125 (glk)
   00052 Galactose metabolism
    ECO111_3125 (glk)
   00500 Starch and sucrose metabolism
    ECO111_3125 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ECO111_3125 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ECO111_3125 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ECO111_3125 (glk)
Enzymes [BR:eoi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ECO111_3125 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: BAI36943
UniProt: C8UDX1
Structure
PDB: 

Position
complement(3078252..3079217)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVI
MGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVYDIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgcattagtcggtgatgtgggcggcaccaacgcacgtcttgctctgtgt
gatattgccagtggtgaaatctcgcaggctaagacctattcagggcttgattaccccagc
ctcgaagcggtcattcgcgtttatcttgaagaacataaggtcgaggtgaaagacggctgt
attgccatcgcttgcccaattaccggtgactgggtggcaatgaccaaccatacctgggcg
ttctcaattgccgaaatgaaaaagaatctcggttttagccatctggaaattattaacgat
tttaccgctgtatcgatggcgatcccgatgctgaaaaaagagcatctgattcagtttggt
ggcgcagaaccggtcgaaggtaaacctattgcggtttacggtgccggaacagggcttggg
gttgcgcatctggtccatgtcgataagcgttgggtaagcttgccgggcgaaggcggtcac
gttgattttgcgccgaatagtgaagaagaggccattatcctcgaaatactgcgtgcggaa
attggccatgtttcggcggaacgcgtgctttctggccctgggctggtgaatttgtatcgc
gcaattgtgaaagctgacaaccgcctgccagaaaatctcaagccaaaagatattaccgaa
cgtgcgctggctgacagctgcaccgattgccgccgcgcgttgtcgctgttttgcgtcatt
atgggccgttttggcggcaatctggcgctcaatctcgggacatttggcggcgtgtttatt
gcgggcggtatcgtgccgcgcttccttgagttcttcaaagcctctggtttccgtgccgca
tttgaagataaagggcgctttaaagaatatgtctatgatattccggtgtatctcatcgtc
catgacaatccgggtcttctcggttccggtgcacatttacgccagaccttaggtcacatt
ctgtaa

DBGET integrated database retrieval system