KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_3266Help
Entry
ECO111_3266       CDS       T01097                                 

Gene name
hcaD
Definition
(GenBank) phenylpropionate dioxygenase, ferredoxin reductase subunit
  KO
K00529  3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin reductase component [EC:1.18.1.3]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00071  Fatty acid degradation
eoi00360  Phenylalanine metabolism
eoi01120  Microbial metabolism in diverse environments
eoi01220  Degradation of aromatic compounds
Module
eoi_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eoi00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    ECO111_3266 (hcaD)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    ECO111_3266 (hcaD)
Enzymes [BR:eoi01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     ECO111_3266 (hcaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Reductase_C Pyr_redox HI0933_like NAD_binding_8 Lycopene_cycl K_oxygenase Pyr_redox_3 NAD_binding_7 DAO Trp_halogenase Thi4 Amino_oxidase 3HCDH_N TrkA_N 2-Hacid_dh_C XdhC_C AlaDh_PNT_C FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: BAI37082
UniProt: C8UEB0
Position
3232745..3233947
Genome map
AA seq 400 aa AA seqDB search
MKEKTIIIVGGGQAAAMAAASLRQQGFTGELHLFSDERHLPYERPPLSKSMLLEDSPQLQ
QVLPANWWQENNVHLHSGVTIKTLGRDTRELVLTNGESWHWDQLFIATGAAARPLPLLDA
LGERCFTLRHAGDAARLREVLQPERSVVIVGAGTIGLELAASATQRRCKVTVIELAATVM
GRNAPPPVQRYLLQRHQQAGVRILLNNAIEHVVDGEKVELTLQSGETLQADVVIYGIGIS
ANEQLAREANLDTANGIVIDEACRTCDPAIFAGGDVAITRLDNGALHRCESWENANNQAQ
IAAAAMLGLPLPLLPPPWFWSDQYSDNLQFIGDMRGDDWLCRGNPETQKAIWFNLQNGVL
IGAVTLNQGREIRPIRKWIQSGKTFDAKLLIDENIALKSL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaaaccatcattattgtcggtggcgggcaagcggcggcaatggctgcggcc
tcgctacgccagcaagggttcaccggtgagctgcatctgttttccgatgagcgacatctt
ccttatgaacgacctccactctcgaaatccatgttgctggaagattccccgcagttacag
caggtgttacccgctaactggtggcaggaaaacaatgttcatctgcattccggtgtaacc
atcaaaacgctgggtcgcgacacacgagagttagtgttaaccaacggcgaaagctggcac
tgggatcagctttttatagcaaccggcgcggcagctcgaccgctgccgttgcttgatgca
ctgggagaacgctgctttaccctacgccatgccggtgatgccgccagactgcgagaagtt
ctgcagcccgaacggtcagtcgtgattgtcggtgccggaactattggtctggaactggct
gccagcgccacgcagcgcagatgtaaggtgacagtgattgaactggcggcaaccgtcatg
ggccgtaatgcaccaccgcccgtgcaacgctatcttttacagcgccaccagcaggctggt
gtgcgcattctgctcaataatgccattgaacatgtggtcgatggtgaaaaagtagaactg
acgctgcaaagtggggaaacgcttcaggctgatgtggtgatttacggtattggtatcagc
gccaacgagcaactggctcgcgaggccaaccttgatactgccaatggcattgtcattgat
gaggcttgccgcacctgcgatcccgcgatctttgccggtggcgatgtggcaatcactcgt
cttgataatggtgcactacaccgctgcgaaagctgggaaaacgccaataaccaggcgcaa
attgccgctgccgcaatgttagggctaccgctaccgctactgccgccgccgtggttctgg
agcgatcagtacagtgataacttacagtttattggcgatatgcgtggcgatgactggctt
tgtcgtggcaacccggaaactcagaaggcgatttggtttaatctgcaaaacggcgtgctt
atcggtgcggtcacgctgaatcaggggcgtgagattcgcccaattcgcaaatggatccag
agcggcaaaacgtttgatgcgaaactgctgatagatgagaacatcgcgcttaaatcactg
taa

DBGET integrated database retrieval system