KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_3948Help
Entry
ECO111_3948       CDS       T01097                                 

Gene name
garL
Definition
(GenBank) alpha-dehydro-beta-deoxy-D-glucarate aldolase
  KO
K01630  2-dehydro-3-deoxyglucarate aldolase [EC:4.1.2.20]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00053  Ascorbate and aldarate metabolism
eoi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eoi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    ECO111_3948 (garL)
Enzymes [BR:eoi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.20  2-dehydro-3-deoxyglucarate aldolase
     ECO111_3948 (garL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI PK Catalase_C
Motif
Other DBs
NCBI-ProteinID: BAI37728
UniProt: C8UG84
Structure
PDB: 

Position
complement(3938165..3938935)
Genome map
AA seq 256 aa AA seqDB search
MNNDVFPNKFKAALAAKQVQIGCWSALSNPISTEVLGLAGFDWLVLDGEHAPNDISTFIP
QLMALKGSASAPVVRVPTNEPVIIKRLLDIGFYNFLIPFVETKEEAEQAVASTRYPPEGI
RGVSVSHRANMFGTVADYFAQSNKNITILVQIESQQGVDNVDAIAATEGVDGIFVGPSDL
AAALGHLGNASHPDVQKAIQHIFNRASAHGKPSGILAPVEADARRYLEWGATFVAVGSDL
GVFRSATKKLADTFKK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaataacgatgttttcccgaataaattcaaagccgcactggctgcgaaacaggtacaa
attggttgctggtcagcactctctaacccgattagcactgaagttcttggtttggctggg
tttgactggctggtgctggatggcgaacatgcgccaaacgatatctccacgtttattccg
cagttaatggccctgaaaggcagcgccagcgcgccagtagtgcgagtgccgaccaacgag
ccggtaattattaagcgtcttctggatatcggtttctataacttcctgattccttttgta
gaaacaaaagaggaagcagagcaggcggtggcatcaacccgttacccaccggaaggcatt
cgcggcgtctccgtttctcaccgcgccaatatgtttggcaccgtggcggattatttcgct
cagtcgaacaagaacatcaccattctggtccagatagaaagtcagcagggcgtagataac
gtcgatgccattgccgctaccgaaggtgtagacggtatcttcgtcggccccagcgatctg
gctgcggcattaggccatctcggcaatgcctcgcacccggatgtacaaaaagcaattcag
cacatttttaaccgtgccagtgcgcacggcaaacccagcggtattctcgcgccggtcgaa
gccgatgcgcgtcgttatctggaatggggtgcgacgtttgtggctgtcggcagcgatctt
ggcgtcttccgctctgccactaagaaactggctgatacctttaaaaaataa

DBGET integrated database retrieval system