KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_4838Help
Entry
ECO111_4838       CDS       T01097                                 

Definition
(GenBank) sorbose-permease PTS system IIA component
  KO
K02812  PTS system, sorbose-specific IIA component [EC:2.7.1.206]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00051  Fructose and mannose metabolism
eoi01100  Metabolic pathways
eoi02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:eoi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ECO111_4838
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ECO111_4838
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eoi02000]
    ECO111_4838
Enzymes [BR:eoi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     ECO111_4838
Transporters [BR:eoi02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    ECO111_4838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIA-man STb_secrete HTH_DeoR
Motif
Other DBs
NCBI-ProteinID: BAI38583
UniProt: C8UKS3
Position
complement(4920253..4920660)
Genome map
AA seq 135 aa AA seqDB search
MVNAIFCAHGKLACAMLESVQMVYGNANVEAVEFVPGENAGDIVAKLEKLVSIHNQDEWL
IAVDLQCGSPWNAAAMLAMRNPRLRVISGLSLPLALELVDNQDSMNVDELCEHLTQIAKQ
TCVVWKQLATAEEDF
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacgccattttttgtgcccacggcaaattagcttgcgccatgctggaatcggtt
cagatggtttacggcaacgccaatgttgaagccgttgaatttgtgcccggcgagaacgcc
ggagacatcgtagcaaagctggaaaagttagtaagcattcacaatcaagatgagtggctg
attgccgtggatttacagtgcggcagcccgtggaatgcggcagcgatgcttgcgatgcgc
aatcctcgtctgcgggtaatcagcggcctttctctgccgctggcgctcgaactggttgat
aaccaggacagcatgaatgttgatgaactgtgtgaacacctgacgcaaatcgcaaagcaa
acctgcgttgtctggaaacaactggcaacggcagaggaggatttctga

DBGET integrated database retrieval system