KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_4961Help
Entry
ECO111_4961       CDS       T01097                                 

Definition
(GenBank) hypothetical protein
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00030  Pentose phosphate pathway
eoi00051  Fructose and mannose metabolism
eoi01100  Metabolic pathways
eoi01110  Biosynthesis of secondary metabolites
eoi01120  Microbial metabolism in diverse environments
eoi01130  Biosynthesis of antibiotics
eoi01200  Carbon metabolism
eoi01230  Biosynthesis of amino acids
Module
eoi_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
eoi_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:eoi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECO111_4961
   00051 Fructose and mannose metabolism
    ECO111_4961
Enzymes [BR:eoi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     ECO111_4961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB UCR_TM
Motif
Other DBs
NCBI-ProteinID: BAI38695
UniProt: C8ULT9
Structure
PDB: 

Position
5046130..5046408
Genome map
AA seq 92 aa AA seqDB search
MGGHVAGTAGFCVAVPAFYSWSMSEVIDKDTRSSERTDYPHYASEVALAFGSRVVGLELA
KMIVDAWLGAQYEGGRHQQRVEAITAIEQRRN
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtcatgtcgctggcaccgcaggattctgtgttgctgtgccagccttttattca
tggtcaatgagtgaggtgattgataaagacaccaggtcgtcagagcgcactgattatccg
cattatgccagtgaagttgcactggcttttggttcacgagtggttggcctcgaactggca
aaaatgattgtggatgcgtggctgggcgcacagtacgaaggcggtcgtcatcaacaacgc
gtggaggcgattacggcaatagagcagcggagaaattga

DBGET integrated database retrieval system