KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_p3-62Help
Entry
ECO111_p3-62      CDS       T01097                                 

Definition
(GenBank) pilus assembly and synthesis protein TraL
  KO
K12068  conjugal transfer pilus assembly protein TraL
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Brite
KEGG Orthology (KO) [BR:eoi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eoi02044]
    ECO111_p3-62
Secretion system [BR:eoi02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ECO111_p3-62
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraL
Motif
Other DBs
NCBI-ProteinID: BAI39369
UniProt: C8URG7
Position
pO111_3:45915..46226
Genome map
AA seq 103 aa AA seqDB search
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGITTSKYLFGIGAAVLVFFG
IKKLKKGRGSSWLRDLIYWYMPTALLCGIFHNVPDSCFRQWIK
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggagacgagaataaacttaagaaatatcgtttcccggaaacactgaccaaccag
agccgctggtttggcctgccactggatgaactgatccccgcagcaatctgtattggctgg
ggtatcacaacatcgaaatatctgttcggtattggtgcagcggttctggtttttttcggg
attaaaaaactgaaaaaagggcggggcagttcctggttacgtgacctgatttactggtat
atgccaacagccctgctgtgcggtatttttcataatgttcccgattcgtgtttccggcag
tggattaaatag

DBGET integrated database retrieval system