KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_p3-65Help
Entry
ECO111_p3-65      CDS       T01097                                 

Definition
(GenBank) pilus assembly protein TraB
  KO
K12065  conjugal transfer pilus assembly protein TraB
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Brite
KEGG Orthology (KO) [BR:eoi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eoi02044]
    ECO111_p3-65
Secretion system [BR:eoi02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ECO111_p3-65
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbI Lebercilin CALCOCO1 TAP42 ATG16 HAUS6_N DivIC
Motif
Other DBs
NCBI-ProteinID: BAI39372
UniProt: C8URH0
Position
pO111_3:47529..48956
Genome map
AA seq 475 aa AA seqDB search
MASINTIVKRKQYLWLGIVVVGTASAIGGALYLSDVDMSGNGESVAEQEPVPDMTGVVDT
TFDDKVRQHATTEMQVTAAQMQKQYEEIRRELDVLNKQRGDDQRRIEKLGQDNAALAEQV
KALGANPVTATGEPVPQTPASPPGPEGEPQPGNTPVSFPPQGSVAVPPPTAFYPGNGVTP
PPQVTYQSVPVPNRIQRKVFTRNEGKQGPSLPYIPSGSFAKAMLIEGADANASVTGNEST
VPMQLRITGLVEMPNSKTYDATGCFVGLEAWGDVSSERAIVRTRNISCLKDGKTIDMPIK
GHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQPAVGLGATAAYGAGDV
LKMGIGGGASKAAQTLSDYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTVEEMALERT
QNRAEEDNPESPVPVPPSAESHLNGFNTDQMLKQLGNLNPQQFMSGSQGGGNDGK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggccagtatcaataccattgtgaaacgcaagcagtacctgtggctggggattgtggtt
gtcggtacagcctccgcgattggtggggcactgtatctgtctgatgtggacatgtccggt
aacggtgaaagcgtggctgaacaggagcctgtgccggatatgaccggtgtggtggatacg
acctttgatgacaaggtgcgtcagcatgccaccaccgagatgcaggtgacggcagcgcag
atgcagaagcagtatgaggaaatccgtcgtgagctggatgttctgaacaaacagcgcggt
gatgaccagcgtcgtattgaaaagttgggacaggacaatgccgccctggcagagcaggta
aaagccctgggtgctaatcccgtcaccgcgaccggtgagccagtaccgcagacgccagcc
tcaccgcccggcccggaaggcgaaccacagccaggaaacacacccgtatctttcccgccg
cagggcagcgttgctgttccaccgccgacggcgttttatcccgggaatggtgtcacgcca
ccaccgcaggtgacgtaccagtctgtaccggtgcctaaccggatacagcgtaaggtgttc
acccgtaatgagggaaaacagggaccatcactgccgtacattccgtcaggaagttttgcg
aaagccatgctgattgaaggagcggatgccaatgcctcagtcaccggtaatgaatccacg
gtgccgatgcagctgcgtatcaccggtctggtggaaatgccgaacagcaaaacgtatgac
gcaacgggatgttttgtgggtctggaagcctggggggatgtgtccagtgaacgtgccatt
gtacgcacccgcaatatcagctgcctgaaggacggcaaaactattgatatgccgattaag
gggcatgtcagcttccggggtaaaaacggtatcaagggcgaagtggtgatgcgtaacggc
aaaatcctcggctgggcatggggcgcgggatttgttgacggtatcggtcagggaatggag
cgcgcctcccagccggctgtcgggctgggtgccactgctgcttacggggccggcgatgtc
ctgaaaatgggtatcggtggcggcgcatcgaaagccgcacagacgctcagtgactactac
atcaaacgtgccgaacagtatcacccggtgataccgattggtgcgggcaacgaagtgacc
gtggtgttccaggacggcttccagctgaaaaccgtggaagagatggcgctggagcgcacg
cagaacagagcggaagaagataatccggaaagtccggttcctgttccgccatcagctgaa
agtcatcttaacggctttaatactgaccagatgctgaagcagctgggcaacctgaatccg
cagcagtttatgtccggcagccagggaggaggcaacgatggcaaataa

DBGET integrated database retrieval system