KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_p3-74Help
Entry
ECO111_p3-74      CDS       T01097                                 

Definition
(GenBank) coupling protein TraD
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrwB_AAD_bind TraD_N TraG-D_C T4SS-DNA_transf AAA_16 Zeta_toxin AAA_10 AAA_22 DUF2207
Motif
Other DBs
NCBI-ProteinID: BAI39379
UniProt: C8URH7
Position
pO111_3:55864..58017
Genome map
AA seq 717 aa AA seqDB search
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIY
WWCTTLEGMRDLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVAL
VICLITFFVVSWILGRQGKQQSENEVTGGRQLTENPKDVARMLKKDGKDSDIRIGDLPII
RDSEIQNFCLHGTVGAGKSEVIRRLANYARQRGDMVVIYDRSGEFVKSYYDPSIDKILNP
LDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQGSGRTIFAEAAYLMRNDPNRS
YSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKAIRYLQGIEHN
GESFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRA
FFRSPSHKIAEFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSL
PDLTCYVTLPGPYPAVKLSLKYQARPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMA
SLFEPDVPEVVSGEDVTQAEQPQQPVSPAINDKKSDSGVNVPAGGIEQELKMKPEEEMEQ
QLPPGISESGEVVDMAAYEAWQQENHPDIQQQMQRREEVNINVHRERGEDVEPGDDF
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaacgcaaaggatatgacccagggcggtcagattgcgtccatgcgtatccgc
atgttcagccagatcgccaatatcatgctttactgcctgtttatttttttctggatactc
gttggtctggttttatgggtaaaaataagctggcagacgtttgtgaacggctgtatttac
tggtggtgtaccacgctggaaggcatgcgggatttaatcaagtcccagccggtatatgag
atccagtattacggcaaaaccttccggatgaacgctgctcaggtactgcatgataaatat
atgatctggtgcggagagcagctatggtccgcattcgttctggctacagttgtggcactg
gttatttgcctgattaccttctttgttgtctcctggattctggggcgtcagggtaaacaa
cagagcgaaaatgaagtcacaggtggtcgtcagctgacggagaacccgaaagacgttgcc
cggatgctgaaaaaagacggcaaggactccgatatacggattggcgacctgccgattatc
cgggattccgaaatccagaacttctgtctgcacggcacggtcggggccggtaagtcggaa
gttatccgtcgtctggccaactacgcccgtcagcgtggagatatggtggtgatttatgac
cgttcaggggaatttgttaaaagttactatgatccctccatcgataagatactgaatccg
ctggatgcccgctgtgccgcctgggatttgtggaaggagtgcctgacacagccggatttt
gataataccgcgaacacgctgatcccgatgggcacaaaagaggacccgttctggcagggt
tcaggacgtaccatttttgcggaagcggcgtacctgatgcgtaatgaccccaaccgcagc
tacagcaaactggtggacacactgctttccatcaaaatcgaaaaactgcgaaccttcctg
cgtaattcaccggcggccaacctggtggaagagaaaattgagaaaacggctatttccatc
cgtgctgtgctgaccaactatgtgaaagccatccgttacctgcaggggattgagcataac
ggtgagtcttttaccatccgtgactggatgcggggtgtccgggaagatcagaaaaacggc
tggctgtttatctcgtcgaatgccgacacccatgcctccctgaagccggtgatctccatg
tggctgtccattgccattcgtggtctgctggcaatgggagaaaaccgtaaccgtcgtgtg
tggtttttctgtgatgagctacccacgttacacaaactgccggacctggtggagatcctg
ccggaagcccgtaagttcggtggctgttatgtgtttggtatccagtcctatgcccagctg
gaagatatctacggtgagaaagcggctgccacgctgtttgacgtcatgaacacccgtgcc
tttttccgttctcccagccataagattgcagagttcgctgccggtgagattggtgagaaa
gagcacctgaaagccagcgagcagtattcctacggtgctgatccggtacgtgacggggta
tcgaccggtaaggatatggagcgccagacgctggtcagttattccgacattcagtctctg
ccggatctgacctgttatgtcaccttgcccggaccgtatccggcagtaaaactctcactg
aaatatcaggcacgtccgaaggttgcccctgagtttattccgcgtgacatcaacccggaa
atggagaaccgtctgagtgccgtacttgccgcaagggaagcagaaggtcgtcagatggcc
agcctcttcgaaccggatgtgccggaagttgtttccggagaagacgtgactcaggctgaa
cagccgcaacagccggtgtctcctgccatcaacgataagaagtcagattcaggtgtgaat
gttccggcaggggggatcgagcaggagctgaaaatgaaaccggaagaagagatggaacag
caactgccacccgggatcagtgaatccggtgaagtggtggatatggccgcttatgaggca
tggcaacaggaaaatcatccggacatccagcagcagatgcagcgtcgtgaagaggtgaac
attaatgtgcaccgggagcgtggggaggatgttgagccgggagatgatttctga

DBGET integrated database retrieval system