KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_p3-76Help
Entry
ECO111_p3-76      CDS       T01097                                 

Definition
(GenBank) putative F pilin acetylation protein TraX
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraX
Motif
Other DBs
NCBI-ProteinID: BAI39381
UniProt: C8URH9
Position
pO111_3:63307..64053
Genome map
AA seq 248 aa AA seqDB search
MTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLMVLDHINLIFQLKQEWM
FLAGRGAFPLFALVWGLNLSRHAHIRQPAINRLWGWGIIAQFAYYLAGFPWYEGNILFAF
AVAAQVLTWCETRSGWRTAAAILLMALWGPLSGSSYGIAGLLMLAVSHRLYRAEDRAERL
ALVACLLAVIPALNLATSDAAAVAGLVMTVLTVGLVSCAGKSLPRFWPGDFFPVFYACHL
AVLGVLAL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacaacggataacacgaatacgacacgtaacgattcactggctgcacggaccgatacc
tggttgcagtcgtttctggtctggtcacccggacagcgggatatcatcaaaacggtggca
ctggtgctgatggtactggaccacatcaatctgatattccagctgaagcaggaatggatg
tttctggccgggcgaggagcctttccgctgtttgccctggtgtgggggctgaatctgtcc
cgtcatgcgcatatccggcaaccggccattaaccggctgtggggatggggaattattgcc
cagttcgcatattatctggccggctttccctggtatgaggggaatatcctgtttgccttt
gcagtggcggcacaggtgctgacgtggtgtgaaacgcgcagtgggtggcgtacagcagcg
gccattcttctgatggccctgtgggggcctttgtccggctccagttacggcattgccggg
ctgctgatgctggcagtcagtcaccggctgtaccgggcggaagacagagcggaacgtctg
gcgctggtcgcctgcctgctggctgttattccagcgcttaaccttgccaccagtgatgca
gcggcggtggccggtcttgtgatgacggtgctgaccgttggtctggtgtcgtgtgcagga
aaatcattaccccgtttctggcccggggattttttcccggtattctacgcctgtcatctg
gctgtgctgggcgttctggcgttgtga

DBGET integrated database retrieval system