KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_1997Help
Entry
ECO26_1997        CDS       T01098                                 

Gene name
paaF
Definition
(GenBank) enoyl-CoA hydratase-isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
eoj00071  Fatty acid degradation
eoj00280  Valine, leucine and isoleucine degradation
eoj00281  Geraniol degradation
eoj00310  Lysine degradation
eoj00360  Phenylalanine metabolism
eoj00362  Benzoate degradation
eoj00380  Tryptophan metabolism
eoj00410  beta-Alanine metabolism
eoj00627  Aminobenzoate degradation
eoj00640  Propanoate metabolism
eoj00650  Butanoate metabolism
eoj00903  Limonene and pinene degradation
eoj00930  Caprolactam degradation
eoj01100  Metabolic pathways
eoj01110  Biosynthesis of secondary metabolites
eoj01120  Microbial metabolism in diverse environments
eoj01130  Biosynthesis of antibiotics
eoj01212  Fatty acid metabolism
Module
eoj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eoj00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECO26_1997 (paaF)
   00650 Butanoate metabolism
    ECO26_1997 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    ECO26_1997 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECO26_1997 (paaF)
   00310 Lysine degradation
    ECO26_1997 (paaF)
   00360 Phenylalanine metabolism
    ECO26_1997 (paaF)
   00380 Tryptophan metabolism
    ECO26_1997 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECO26_1997 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECO26_1997 (paaF)
   00281 Geraniol degradation
    ECO26_1997 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECO26_1997 (paaF)
   00627 Aminobenzoate degradation
    ECO26_1997 (paaF)
   00930 Caprolactam degradation
    ECO26_1997 (paaF)
Enzymes [BR:eoj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECO26_1997 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: BAI25275
Structure
PDB: 

Position
1940514..1941281
Genome map
AA seq 255 aa AA seqDB search
MSELIVSRQQRVLLLTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITGNARFFA
AGADLNEMAEKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAG
ENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPS
DLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEG
ISAFLQKRTPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgatcgtcagccgtcagcaacgagtattgttgctgacccttaaccgtccc
gccgcacgtaatgcgctaaataatgccctgctgatgcaactggtaaatgaactggaagct
gcggctaccgataccagcatttcggtctgtgtgattaccggtaatgcacgcttttttgcc
gctggggccgatctcaacgaaatggcagaaaaagatctcgcggccaccttaaacgataca
cgtccgcagctatgggcgcgattgcaggcctttaataaaccacttatcgcagccgtcaat
ggttacgcgcttggggcgggttgcgaactggcattgttgtgcgatgtggtggttgccgga
gagaacgcgcgttttgggttgccggaaatcactctcggcatcatgcctggcgcaggcgga
acgcaacgtttaatccgtagtgtcggtaaatcgttagccagcaaaatggtgctgagcgga
gaaagtatcaccgcccagcaagcacagcaggccgggctggttagcgacgtcttccccagc
gatttaaccctcgaatacgccttacagctggcatcgaaaatggcacgtcactcgccgttg
gccttacaagcggcaaagcaagcgctgcgccagtcgcaggaagtggctttgcaagccgga
cttgcccaggagcgacagttattcaccttgctggcggcaacagaagatcgtcatgaaggc
atctccgctttcttacaaaaacgcacgcccgactttaaaggacgctaa

DBGET integrated database retrieval system