KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_3729Help
Entry
ECO26_3729        CDS       T01098                                 

Gene name
ihgO
Definition
(GenBank) L-2-hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
eoj00310  Lysine degradation
eoj01100  Metabolic pathways
eoj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eoj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    ECO26_3729 (ihgO)
Enzymes [BR:eoj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     ECO26_3729 (ihgO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo Pyr_redox_2 Amino_oxidase NAD_binding_8 Pyr_redox_3 FAD_binding_2 Trp_halogenase Lycopene_cycl Thi4
Motif
Other DBs
NCBI-ProteinID: BAI26922
Position
3668349..3669617
Genome map
AA seq 422 aa AA seqDB search
MYDFVIIGGGIIGMSTAMQLIDVYPDARIALLEKESGPACHQTGHNSGVIHAGVYYTPGS
LKAQFCLAGNRATKAFCDQNDIRYDNCGKMLVATSDLEMERMRALWERTAANGIEREWLN
AEELREREPNITGLGGIFVPSSGIVSYREVTAAMAKIFQARGGEIIYNAEVSALSEHKNG
VVVRTRQGGEYEASTLISCSGLMADRLVKMLGLEPGFIICPFRGEYFRLAPEHNQIVNHL
IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLAFKREGYRKRDFSFSDTLEILGSSGIRR
VLQNHLRSGLGEMKNSLCKSGYLRLVQKYCPRLSLSDLQPWPAGVRAQAVSPDGKLIDDF
LFVTTPRTIHTCNAPSPAATSAIPIGAHIVSKVQTLLASQSNPGRTLRAARSVDALHAAF
NQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtatgattttgtgattattggcggcggcatcatcggcatgtcgaccgccatgcaactg
attgatgtttatccggatgcccgcattgcgttgctggaaaaagagtccggcccggcctgt
caccagacgggccacaacagcggcgtgatccatgccggggtctattacacgcccggcagc
ctgaaggcgcagttttgcctggcgggaaaccgcgccaccaaagccttttgcgatcaaaac
gacattcgctatgacaactgcggcaagatgctggtcgccacgtccgatctcgaaatggaa
cggatgcgcgcgttgtgggaacgcacggcggcgaacggtatcgagcgcgagtggttaaac
gccgaggaactgcgcgagcgcgaaccgaatatcaccgggctcggcggcatttttgtgccg
tccagcggcattgtcagctatcgcgaagtcacagcggcaatggcaaaaatcttccaggcc
agaggcggtgagattatttataacgccgaagtcagcgccctcagtgagcataaaaacggc
gtggtcgtccgaacccgtcagggcggcgaatatgaagcatcgacgctgattagctgttcc
gggctgatggctgaccggctggtgaaaatgctcggcctcgaaccgggttttattatctgc
ccgttccgtggcgagtatttccgccttgcgccggagcataaccagattgttaaccatctg
atttaccccattcccgacccggcaatgccatttttgggcgtgcatctcacccgaatgatc
gatggcagcgtcaccgtcgggccaaacgcggtgctggctttcaaacgcgaaggctatcgc
aagcgcgacttctcatttagcgacacgctggagattttgggctcgtcggggattcgccgg
gtgctgcaaaaccatctacgctcaggactgggcgagatgaaaaactcgctgtgcaaaagc
ggctatctgcgcctggtgcaaaagtattgtccccggctttcgttaagcgatctccagccc
tggcccgccggtgtgcgggcgcaggcagtatcgccggacggcaagctgattgacgatttt
ctgtttgtcaccaccccacgcacgatccacacctgcaatgcgccctccccggcagcgaca
tcagcaattcctattggtgcgcatattgtcagcaaggtacaaacgctgttggcaagccag
agtaaccccggacgcacgctgcgagcggcacgtagtgtggatgccttacacgccgcattt
aatcaataa

DBGET integrated database retrieval system