KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_5130Help
Entry
ECO26_5130        CDS       T01098                                 

Definition
(GenBank) sorbose-permease PTS system IIB component
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
eoj00051  Fructose and mannose metabolism
eoj01100  Metabolic pathways
eoj02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:eoj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ECO26_5130
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ECO26_5130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eoj02000]
    ECO26_5130
Enzymes [BR:eoj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     ECO26_5130
Transporters [BR:eoj02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    ECO26_5130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: BAI28279
Position
complement(5198072..5198566)
Genome map
AA seq 164 aa AA seqDB search
MNITLARIDDRLIHGQVTTVWSKVANAQRIIICNDEVYNDEVRRTLLRQAAPPGMKVNVV
NIEKAVAVYHNPQYQDETVFYLFTRPQDALAMVRQGVKIDTLNIGGMAWRPGKKQLTKAV
SLDDDDINAFHELNNLGVILDLRVVASDPSINIIDKINEQLIAN
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacattacgctcgcccgcattgatgaccgcctgatccacggtcaggtcactaccgtc
tggtcgaaagtggctaacgcccagcgcattattatctgcaatgacgaagtttataacgat
gaagttcgccggacattattgcgtcaggctgcgccaccgggaatgaaggttaacgtggtc
aatattgaaaaagccgtcgctgtttatcacaacccgcaatatcaggacgaaaccgttttt
tatcttttcactcgcccacaggatgccttagcgatggttcgccagggggtaaaaatagac
accctgaatattggcggcatggcctggcggcccggtaaaaaacagttaaccaaagcggtt
tcattagatgatgatgatattaacgcatttcatgagttaaataatcttggcgtcatactg
gatttacgcgtcgtagcgtcagatccctcaatcaatattatcgacaaaataaacgaacag
ttaatcgcaaattaa

DBGET integrated database retrieval system