KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_p2-49
Entry
ECO26_p2-49       CDS       T01098                                 
Name
(GenBank) conjugal transfer protein TraV
  KO
K12064  conjugal transfer pilus assembly protein TraV
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Brite
KEGG Orthology (KO) [BR:eoj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eoj02044]
    ECO26_p2-49
Secretion system [BR:eoj02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ECO26_p2-49
SSDB
Motif
Pfam: TraV LPAM_1
Other DBs
NCBI-ProteinID: BAI28840
Position
pO26_2:30729..31244
AA seq 171 aa
MKQISLFIPLLGTLLLSGCAGTSTEFECNATTSDTCMTMEQANEKAKKLEQSSEAKPVAA
SLPRLAEGKFRTMPVQTVTATTPSGSRPAVTAHPEQKLLAPRPLFTAAREVKTVVPVSSV
APVTPPRPLRTGEQTAALWIAPYIDNQDVYHQPSSVFFVIKPSAWGKPRIN
NT seq 516 nt   +upstreamnt  +downstreamnt
atgaaacagatttctttatttattcctctgctggggaccttattactttccggctgtgcc
ggaaccagtacggaatttgagtgtaacgccaccacatccgatacctgtatgacgatggag
caggccaatgagaaggccaaaaaactggagcagtcctcagaagcaaagccggttgcggca
tcactgccgcgcctggctgaagggaaattccggacaatgccggtgcagaccgtcaccgcg
accactccgtccggcagcagacctgcggtgacagcacatccggagcagaaactgctggca
ccacgcccgctgtttaccgctgcccgggaagtgaaaacggtcgttccggtcagttcagtt
gcaccggtaacacctccccgtccgctaagaacgggtgagcagacggcagcattatggata
gcgccttatattgataaccaggatgtttatcatcagccatccagcgtgttttttgttatt
aaaccgtctgcgtggggaaaaccacgtattaattaa

DBGET integrated database retrieval system