KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_p2-70
Entry
ECO26_p2-70       CDS       T01098                                 
Name
(GenBank) conjugal transfer protein TraH
  KO
K12072  conjugative transfer pilus assembly protein TraH
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Brite
KEGG Orthology (KO) [BR:eoj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eoj02044]
    ECO26_p2-70
Secretion system [BR:eoj02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ECO26_p2-70
SSDB
Motif
Pfam: TraH DUF5667 DUF1722
Other DBs
NCBI-ProteinID: BAI28860
Position
pO26_2:43971..45344
AA seq 457 aa
MPRIKPLLVLCAVLLTVTPAASADVNSDMNQFFNKLGFASNTTQPGVWQGQAAGYAYGGS
LYARTQVKNVQLISMTLPDINAGCGGIDAYLGSFSFINGEQLQRFVKQIMSNAAGYFFDL
ALQTTVPEIKTAKDFLQKMASDINSMNLSSCQAAQGIIGGLFPRTQVSQQKVCQDIAGES
NIFADWAASRQGCTVGGKSDSVRDKASDKDKERVTKNINIMWNALSKNRMFDGNKELKEF
VMTLTGSLVFGPNGEITPLSARTTDRSIIRAMMEGGTAKIYHCNDSDKCLKVVADTPVTI
SRDNALKSQITKLLASIQNKAVSDTPLDDKEKGFISSTTIPVFKYLVDPQMLGVSNSMIY
QLTDYIGYDILLQYIQELIQQARAMVATGNYDEAVIEHINDNMNDATRQIAAFQSQVQVQ
QDALLVVDRQMSYMRQQLSARMLSRYQNNYHFGGSTL
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgcctcgcattaaacctcttctggttctttgtgccgttttactgacggtcacacccgca
gcgtcagcggatgtgaacagcgacatgaatcagttctttaataagctgggcttcgcctcc
aataccacacagccgggcgtctggcaggggcaggccgccggttatgcttacggcggctcc
ctgtatgcccgtactcaggtcaaaaatgttcagctgatttccatgacgctgccggatatc
aatgccggatgtggcggcatcgacgcctatctcggctcgttcagttttattaatggcgag
cagctgcagcgttttgttaagcagattatgagcaatgctgccggttacttttttgacctt
gccctgcagacaacggtgccggaaatcaaaaccgcaaaagacttcctgcagaaaatggca
agcgacattaacagtatgaacctcagttcctgccaggcggcgcaggggattatcggcggg
cttttcccccggacgcaggtgtcccagcaaaaagtctgtcaggacattgccggtgagagc
aatatttttgctgactgggcggcttcccggcagggatgtaccgttggcgggaaatctgac
agcgtcagggataaagccagcgacaaggataaggagcgggtgaccaaaaacattaacatc
atgtggaatgcgctttccaaaaacagaatgtttgacggcaacaaagagctgaaagagttt
gtgatgacgctgaccggctcactggtgtttggtcccaacggcgaaatcacaccgctgtca
gccagaaccactgaccgctcaattatccgggccatgatggaaggcggcacagcaaaaatt
tatcactgcaacgattctgataaatgcctgaaagtggtggcagacacaccggtgaccatc
agccgggataatgcactgaagtctcagattactaaacttctggccagcattcagaacaag
gcggtcagtgacacgcctctggatgacaaggaaaaaggctttatttccagtaccaccatc
cccgtcttcaaatacctggttgacccgcagatgctcggagtttccaacagcatgatttac
cagctgacggactatatcggttacgacatcctgctgcagtacattcaggagctgatacag
caggcccgggcgatggtggccacaggaaattatgacgaagcagttatcgaacatattaac
gacaacatgaatgatgccacccggcagattgcggcgtttcagtcacaggtgcaggtacag
caggatgcgctgctggttgtcgatcgtcagatgagctacatgcgtcagcagctttccgcc
cgcatgctcagtcgttaccagaacaactatcacttcggagggagcacgctgtga

DBGET integrated database retrieval system