KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_0231
Entry
G2583_0231        CDS       T01190                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eok00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    G2583_0231
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eok02044]
    G2583_0231
Secretion system [BR:eok02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   G2583_0231
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: ADD54877
UniProt: D3QWM1
Position
complement(253849..254610)
AA seq 253 aa
MDEGSLSLPPFTGYDEKSLRDYHLALRGNSLNPMIDAATPLLGMVMRLSTMNSQTMPEHL
FAQVVTDVQAVEQLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHF
HNEAWGGEKVFILLERLIREPKRYQDLLEFLWLCFSLGFRGRYKVAVQDQGEFEQIYRRL
YHVLHKLRGDAPFPLLHQDKKTQGGRYQLISRLTVKHIFCGGVVVLALFYLFYLLRLDSQ
TQDILHQLNKLLR
NT seq 762 nt   +upstreamnt  +downstreamnt
atggatgaggggtcactgtctctgccaccatttaccggatacgacgaaaaaagcctgcgc
gactaccatctcgcgcttcgtggcaacagcctgaatccgatgatcgacgcggcgacgccg
ctactcggtatggtaatgcgcctttccaccatgaacagccagacgatgccggagcatctt
tttgctcaggtggtgacagatgttcaggccgtggagcaactgcttcaggaacagggctac
gaaccgggcgtgattatctcgtttcgctacatcctctgcacgtttattgatgaagcggcg
ctcggtaacggctggtcgaacaagaacgagtggatcaagcagtcattgctggtccatttc
cacaacgaagcctggggtggcgagaaagttttcatcctgctggagcgcctgatccgtgaa
cccaaacgttaccaggatctgctggaatttctctggctctgtttttctctgggatttcgc
gggcgctacaaagtggcagtacaggatcagggggaatttgagcagatctaccgccgtctg
taccacgttctgcataaactgcgcggcgatgcccctttcccgctgttacaccaggacaaa
aaaacccagggcgggcgttatcagctcatcagtcgcctgactgttaaacatattttttgt
ggtggcgttgtcgtgctggcgttgttttacctgttctatctgttgcggctggacagccag
acgcaggacatcctgcaccagctaaacaaattacttcgataa

DBGET integrated database retrieval system