KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_0236
Entry
G2583_0236        CDS       T01190                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Brite
KEGG Orthology (KO) [BR:eok00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eok02044]
    G2583_0236
Secretion system [BR:eok02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   G2583_0236
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ADD54882
UniProt: D3QWM6
Position
complement(258820..260670)
AA seq 616 aa
MEFEERYFREELDYLRQLSKLLATEKPHLARFLAEKDADPDIERLLEGVAFLTGNLRQKI
EDEFPELTHGLIKMLWPNYLRPVPAMTLIEYTPDMDKSSVPVLIPRNEQFTTNAGEIRVD
EVLPSDAKKEEPPPCTFTLCRDIWLLPVRLEQIENRSTTRNGVINITFSVAPGTDFRTLD
LNKLRFWLGNDDNYTRDQLYLWFCEYLQGADLTVGEQHIRLPEFMLKAVGFEPQDAMLPW
PKNVHSGYRILQEYFCYPDAFLFFDLCGCPALPDGLQAEFFTLQLRFSRPLPVDIRLRRD
SLRLYCAPAINLFIHHAEAITLDNRRADYPLVPSRHYPQHYDVFSVNSVVSQVQDMFRKK
DLGRPVSTQAARQWPAFESFSHQMEYSRKREVVYWHHRTKTSLFHRGFDHTLAFIHADGS
YPSDESLLSNEVVSVSLTCTNRELPSQIRSGDITGTTGKNAAVASFRNITRPTQPLWPVI
DGSLHWSLLSAMNLNYLSLLDTDALKQVIANFDRHAIHHPQTARLSQQKLDAIERLETRP
VDRLFTGIPVRGLASTLYLHPEPFVCEGEMYLLGTVLSHFLSLYASVNSFHMLTVVNTES
QETWKWTERIGQHPLI
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggaatttgaagaacgctattttcgggaagaactcgattacctgcgccagcttagcaag
ctgctggcaacggaaaaaccccatctggcccgcttcctggccgaaaaagatgcggatccg
gatattgaacgcctgctggaaggggtggcttttcttaccggcaatctccgccagaaaatt
gaggatgaattcccagaactgacgcacgggcttattaagatgctatggcctaattacctg
cgtccggttccggcaatgacccttattgaatatacgccggatatggataagtcttctgta
ccggtgttaatcccccgtaatgagcagtttacaaccaacgccggggaaatcagagttgat
gaagtgctgccctctgatgctaaaaaggaggagccgcctccctgtaccttcaccctctgc
cgggatatctggctgctgcccgttcgcctggagcagattgaaaaccgcagtacgacccgt
aatggtgttatcaacatcaccttttcggtcgcaccgggaacggacttccgcacgctggat
ctgaacaaacttcgcttctggctcggcaatgacgacaactatacccgtgaccagctttat
ttatggttctgcgaatacttgcagggtgccgacctgactgtgggtgaacagcatattcgc
ctgcctgagtttatgctaaaagctgtcggttttgagccgcaggatgccatgctgccctgg
ccgaaaaacgtccacagcggctaccggatccttcaggagtatttctgttaccccgatgcg
tttctcttttttgatctttgtggttgtccggctttgcctgacggattgcaggcggaattc
tttaccctgcaactgcgtttttcgcgccctttgcccgtggacatccggctgcgccgcgat
tccctgcgcctgtattgcgcacctgccattaatttatttatccaccatgcagaagccatc
acgctggacaaccggcgggcagactatccgctggttcccagccgccattacccacaacat
tacgatgtattttccgttaacagtgtggtgagccaggtccaggatatgttcaggaaaaaa
gatctggggcgtcctgtttcgacgcaggccgcgcgccagtggccagcctttgaaagtttc
agccatcagatggaatacagccggaagcgggaagtggtgtactggcatcaccggaccaaa
acatccctgttccatcgcggctttgatcatacccttgcctttatacatgctgatggcagt
tatccgtcagacgaatctctgctcagtaatgaagtggtttcggtatcgctgacctgtacc
aaccgtgagcttccgtcacaaattcgttccggcgatatcaccggcacaaccggtaaaaat
gcggctgttgcttcctttcgcaacattacccgcccgacgcaaccactctggccggtcatt
gatggcagcctgcactggtccctgctctccgccatgaacctgaattatctgtcattactg
gatacggacgcgctgaagcaggtcatcgccaactttgatcgccacgcaatccaccatccg
cagacggcgcggctgtcacaacaaaagctggatgccattgagcgtctggagacccgcccc
gttgatcgcctgtttacgggtattcccgtccggggactggcctccacgctgtatctgcac
ccggagccgtttgtctgtgaaggggaaatgtatctgctcggtacggtgctttcgcatttt
ctgtcgctgtacgccagcgttaactcattccacatgctgaccgttgtgaacacagaaagc
caggagacatggaaatggacggaaagaatcgggcagcatcctcttatctga

DBGET integrated database retrieval system