KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_0239
Entry
G2583_0239        CDS       T01190                                 

Definition
(GenBank) hypothetical protein
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
SSDB
Motif
Pfam: VipB
Other DBs
NCBI-ProteinID: ADD54884
UniProt: D3QWM8
Position
complement(262620..262844)
AA seq 74 aa
MTAHKNISGTYHLSVADILQVVYQVCFSPSVEINQDGVAALITTLDRRISDLLDEIIHFC
EFQQSASHWQRVLH
NT seq 225 nt   +upstreamnt  +downstreamnt
atgacggcacacaaaaatatctccgggacataccacctctctgttgcagacattctgcag
gtggtttaccaggtatgtttcagcccgtccgttgaaatcaaccaggatggtgtggctgcg
ctgattacaacactggatcgccgtatcagtgatctattggatgagattatccatttttgt
gagtttcagcagagcgcgtcgcactggcagcgcgtacttcactga

DBGET integrated database retrieval system