KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_0877Help
Entry
G2583_0877        CDS       T01190                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok00020  Citrate cycle (TCA cycle)
eok00190  Oxidative phosphorylation
eok00650  Butanoate metabolism
eok01100  Metabolic pathways
eok01110  Biosynthesis of secondary metabolites
eok01120  Microbial metabolism in diverse environments
eok01130  Biosynthesis of antibiotics
eok01200  Carbon metabolism
Module
eok_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eok_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eok_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eok00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    G2583_0877 (sdhD)
   00650 Butanoate metabolism
    G2583_0877 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    G2583_0877 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADD55488
UniProt: D3QMQ4
Structure
PDB: 

Position
921669..922016
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFCASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgccaccagt
ggcgagctgacatatgaagtctggatcggtttctgcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggctttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system