KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_0892Help
Entry
G2583_0892        CDS       T01190                                 

Definition
(GenBank) Putative methylaspartate ammonia-lyase
  KO
K04835  methylaspartate ammonia-lyase [EC:4.3.1.2]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok00630  Glyoxylate and dicarboxylate metabolism
eok00660  C5-Branched dibasic acid metabolism
eok01100  Metabolic pathways
eok01120  Microbial metabolism in diverse environments
eok01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    G2583_0892
   00660 C5-Branched dibasic acid metabolism
    G2583_0892
Enzymes [BR:eok01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.2  methylaspartate ammonia-lyase
     G2583_0892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAAL_C MAAL_N MR_MLE_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: ADD55503
UniProt: D3QMR9
Position
complement(938023..939264)
Genome map
AA seq 413 aa AA seqDB search
MKIKQALFTAGYSSFYFDDQQAIKNGAGHDGFFYTGEPVTQGFNAVRQAGECVSVQLILE
NGAVAVGDCTAVQYSGAGGRDPLFLAEHFIPFLNDHIKPLLVGRDVDAFLPNARFFDKLR
IDGNLLHTAVRYGLSQALLDATALATGRLKTEVVCDEWQLPRVAESIPLFGQSGDDRYIA
VDKMILKGIDVLPHALINNVEEKLGFKGEKLREYVRWLSDRILSKRTSARYHPTLHIDVY
GTIGLIFDMDPLRCAQYIASLEKEAQGLPLYIEGPVDAGNKPDQIRLLTAITKELTRLGS
GVKIVADEWCNTYQDIVDFTDAASCHMVQIKTPDLGSIHNIVDAVLYCNSHSMEAYQGGT
CNETDVSARTCVHVALAARPMRMLVKPGMGFDEGLDIVFNEMNRTIALLQAKD
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaaacaggctctgttcaccgctggctactcctcattctatttcgatgaccag
caggcgataaaaaacggagcgggtcatgacggctttttttataccggggagccagtaaca
caggggtttaacgccgtacgtcaggccggggagtgcgtatcggtacagttgattctggaa
aacggcgcggtcgccgtaggtgactgtactgccgtacagtattccggggcaggcggtcgc
gatccactgttcctcgcagagcactttattccgttcctcaacgaccatatcaagccatta
ctggtaggccgcgatgtggatgctttcctgccgaatgcccgtttcttcgacaaattgcgt
attgacggcaacttgctgcataccgccgtgcgctacggattatcacaggcgctgcttgat
gctaccgcgctggcaaccggccgtctgaaaactgaagtggtctgtgatgaatggcagttg
ccacgcgtggcggaatccattccattatttggtcagagcggcgacgatcgatatatcgcc
gtcgataagatgatccttaaaggcatcgacgtgctgccccatgcgctgattaataacgtc
gaagagaagctgggctttaaaggtgaaaaactgcgcgaatatgtccgctggttgtcggat
cgcattctaagcaagcgcaccagcgcacgctaccaccctaccctgcacatcgatgtatac
ggcactatcggtctgatcttcgatatggatccgcttcgctgtgcgcaatacatcgccagc
ctggaaaaagaagcgcaaggcctgccgctctacatcgaagggccggtcgatgccggtaac
aagcccgatcaaattcgcctgctgaccgcgattaccaaagagctgacgcgcctcggttcc
ggcgtgaaaattgtggccgatgaatggtgtaacacctaccaggatattgttgatttcact
gatgctgccagttgtcacatggtgcaaatcaaaaccccggatctgggcagtattcacaac
atcgtcgatgcggttctttactgcaacagccacagcatggaagcgtaccagggcggcacc
tgcaatgaaactgatgtcagtgcccgcacctgtgtccacgtcgcccttgccgctcgcccc
atgcgtatgctggtaaaaccagggatgggctttgacgaaggcctcgatatcgtcttcaac
gaaatgaatcgtactatcgcgctgttgcaggctaaggattaa

DBGET integrated database retrieval system