KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_2564Help
Entry
G2583_2564        CDS       T01190                                 

Gene name
galF
Definition
(GenBank) UDP-glucose pyrophosphorylase GalF
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok00040  Pentose and glucuronate interconversions
eok00052  Galactose metabolism
eok00500  Starch and sucrose metabolism
eok00520  Amino sugar and nucleotide sugar metabolism
eok01100  Metabolic pathways
eok01130  Biosynthesis of antibiotics
Module
eok_M00362  Nucleotide sugar biosynthesis, prokaryotes
eok_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eok00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    G2583_2564 (galF)
   00052 Galactose metabolism
    G2583_2564 (galF)
   00500 Starch and sucrose metabolism
    G2583_2564 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    G2583_2564 (galF)
Enzymes [BR:eok01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     G2583_2564 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADD57115
UniProt: D3QY23
Position
complement(2568181..2569074)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFLKNIEQLLAK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttataccggtagcaggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcgtccaag
aacgcagtcgaaaaccacttcgacacctcttatgaattagaatctctccttgaacagcgc
gtgaagcgtcaactactggcggaagtacaatctatctgtccgccgggcgtgaccattatg
aacgtgcgtcagggtgaacctttaggtttaggccactccattttatgtgcgcgacctgcc
attggtgacaatccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagcgcc
gacccgttgcgttacaaccttgctgccatgattgcgcgcttcaatgaaacgggccgtagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactccgtcatccagaccaaa
gaaccgctggatcgtgaaggtaaagtcagccgcattgttgaatttatcgaaaaaccggat
cagccgcagacgctggactcagacataatggccgttggtcgctatgtgctttctgccgat
atttggccggaacttgaacgcactcaacctggtgcatgggggcgtattcagctgactgat
gctattgccgaactggcgaaaaaacagtccgttgatgccatgctgatgactggtgacagc
tacgactgtggtaaaaaaatgggctatatgcaggcgttcgtgaagtatgggctgcgcaac
ctaaaggaaggtgcgaaatttctcaagaatattgagcaattacttgctaaataa

DBGET integrated database retrieval system