KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_4100Help
Entry
G2583_4100        CDS       T01190                                 

Gene name
pck
Definition
(GenBank) Phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok00010  Glycolysis / Gluconeogenesis
eok00020  Citrate cycle (TCA cycle)
eok00620  Pyruvate metabolism
eok01100  Metabolic pathways
eok01110  Biosynthesis of secondary metabolites
eok01120  Microbial metabolism in diverse environments
eok01130  Biosynthesis of antibiotics
eok01200  Carbon metabolism
Module
eok_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    G2583_4100 (pck)
   00020 Citrate cycle (TCA cycle)
    G2583_4100 (pck)
   00620 Pyruvate metabolism
    G2583_4100 (pck)
Enzymes [BR:eok01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     G2583_4100 (pck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: ADD58573
UniProt: D3QTM0
Structure
PDB: 

Position
4133632..4135254
Genome map
AA seq 540 aa AA seqDB search
MRVNNGLTPQELEAYGISDVHDIVYNPSYDLLYQEELDPSLTGYERGVLTNLGAVAVDTG
IFTGRSPKDKYIVRDDTTRDTFWWADKGKGKNDNKPLSPETWQHLKGLVTKQLSGKRLFV
VDAFCGANPDTRLSVRFITEVAWQAHFVKNMFIRPSDEELAGFKPDFIVMNGAKCTNPQW
KEQGLNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSMMNYLLPLKGIASMHCSANVSEK
GDVAVFFGLSGTGKTTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIKLSKEAEPEI
YNAIRRDALLENVTVREDGTIDFDDGSKTENTRVSYPIYHIDNIVKPVSKAGHATKVIFL
TADAFGVLPPVSRLTADQTQYHFLSGFTAKLAGTERGITEPTPTFSACFGAAFLSLHPTQ
YAEVLVKRMQAAGAQAYLVNTGWNGTGKRISIKDTRAIIDAILNGSLDNAETFTLPMFNL
AIPTELPGVDTKILDPRNTYASPEQWQEKAETLAKLFIDNFDKYTDTPAGAALVAAGPKL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttaacaatggtttgaccccgcaagaactcgaggcttatggtatcagtgacgta
catgatatcgtttacaacccaagctacgacctgctgtatcaggaagagctcgatccgagc
ctgacaggttatgagcgcggggtgttaactaatctgggtgccgttgccgtcgataccggg
atcttcaccggtcgttcaccaaaagataagtatatcgtccgtgacgataccactcgcgat
actttctggtgggcagacaaaggcaaaggtaagaacgataacaaacctctctctccggaa
acctggcaacatctgaaaggcctggtgaccaaacagctttccggcaaacgtctgttcgtt
gtcgacgccttctgtggtgcgaacccggatactcgtctttccgtccgtttcatcaccgaa
gtggcctggcaggcgcattttgtcaaaaacatgtttattcgcccgagcgatgaagagttg
gcaggtttcaaaccagactttatcgttatgaacggcgcgaagtgcactaacccgcagtgg
aaagaacagggtctgaattccgaaaacttcgtggcttttaacctgaccgagcgcatgcag
ctgattggcggcacctggtatggcggcgaaatgaagaaagggatgttctcgatgatgaac
tacctgctgccgctgaaaggtatcgcttctatgcactgctccgccaacgttagcgagaaa
ggcgatgttgcggtgttcttcggcctttccggcaccggtaaaaccaccctttccaccgac
ccgaaacgtcgcctgattggcgatgacgaacacggctgggacgatgacggcgtgtttaac
ttcgaaggcggctgctacgcaaaaactatcaagctgtcgaaagaagcggaacctgaaatc
tacaacgctatccgtcgcgatgcgctgctggaaaacgtcaccgtgcgtgaagatggcact
atcgactttgatgatggttcaaaaaccgagaacacccgcgtttcttatccgatctatcac
atcgataacatcgttaagccggtttcaaaagcgggtcacgcaacgaaagttatcttcctg
accgcagacgcctttggtgtgctgccaccggtttctcgtctgactgccgatcaaacccag
taccacttcctctctggcttcaccgccaaactggccggtactgagcgtggcatcaccgaa
ccgacgccaaccttctccgcttgcttcggcgcggcattcctgtcgctgcacccgactcag
tacgcagaagtgctggtgaaacgtatgcaggcggcgggcgcgcaggcttatctggttaac
actggctggaacggcactggcaaacgtatctcgattaaagatacccgcgccattatcgac
gccatcctcaacggttcgctggataatgcagaaaccttcactctgccgatgtttaacctg
gcgatcccaaccgaactgccgggcgtagacacgaagattctcgatccgcgtaacacctac
gcttccccggaacagtggcaggaaaaagccgaaaccctggcgaaactgtttatcgacaac
tttgataaatacaccgacacccctgcgggtgccgcgctggtagcggctggtccgaaactg
taa

DBGET integrated database retrieval system