KEGG   Emticicia oligotrophica: Emtol_1010Help
Entry
Emtol_1010        CDS       T02272                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
eol  Emticicia oligotrophica
Pathway
eol00020  Citrate cycle (TCA cycle)
eol00310  Lysine degradation
eol01100  Metabolic pathways
eol01110  Biosynthesis of secondary metabolites
eol01120  Microbial metabolism in diverse environments
eol01130  Biosynthesis of antibiotics
eol01200  Carbon metabolism
Module
eol_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eol_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Emtol_1010
  Amino acid metabolism
   00310 Lysine degradation
    Emtol_1010
Enzymes [BR:eol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Emtol_1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AFK02161
UniProt: I2ER58
Position
788227..789777
Genome map
AA seq 516 aa AA seqDB search
MAIEMKVPSVGESVSEVTIASWTKKDGDLVKMDEVICELESDKATFELPAEADGILRIVA
PEGTTLPIGALICKIEAAGSTAAAAPAAAEAPKAVAEAPAAPVATKVIDVVVPAVGESIS
EVTIAAWSKKEGDSVKMDEVICELESDKATFELPSPENGVLTIVAQAGQVVPIGGVVAKI
TVGGSQSVAGGVPLSSPQPVAPVTQNSELKTQNSENYAAGHPSPVAAKVLAEKGIDPASV
QGTGVGGRITKDDAVKAEKPAVTPAPQVAKPAATPAAAPASEEGRSSRREKMTSLRKTIA
KRLVAVKQETAMLTTFNEVDMKPIMDLRAKYKDKFKEVHGVGLGFMSFFTKACAIALKEF
PLVNSYIDGDEIVYNDYADIAIAVSAPRGLVVPVIRSAEKLNFAQIESEVVRLAVKAREN
KLTIEEMTGGTFTITNGGIFGSMLSTPIINAPQSAILGMHNIVERPVVVNGEIVVRPIMY
VALSYDHRTIDGKDSVSFLVRVKQLLEDPTRILLGV
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagaaatgaaagtcccttcggtgggcgaatcagtaagcgaagtaaccatcgct
tcttggacaaaaaaagacggtgatttagtgaaaatggacgaggttatctgcgaattagag
tcagataaagctactttcgaattacccgccgaagccgacggaattctaagaatagtagct
ccagaaggaacaacccttccaattggggcattgatatgtaaaatcgaagctgcgggaagt
acagcagcagcagctcctgcggcagctgaagctccaaaagcagtggccgaagcaccagca
gctccagttgctacgaaagtaattgatgtagttgtaccagcagttggtgaatcaatttca
gaggttaccattgctgcttggagcaaaaaagaaggtgatagcgtaaaaatggacgaagtt
atctgcgaactcgaatcagataaagctactttcgaattaccttcaccagaaaatggagta
ttgacaatcgttgcacaagcgggtcaagttgtaccaattggcggagtagtagctaagatt
acagttggcggctctcagtcggtagcgggcggcgttccgcttagcagtcctcaaccagta
gcacctgtaactcagaactcagaactcaaaactcagaactcagaaaactatgcagcaggt
catccatcaccagtagcagcgaaagttttagccgaaaaaggtatcgaccctgcttctgtt
caaggtacaggtgtaggtggacgtatcacgaaagacgatgcagtaaaagctgaaaaacca
gcagttactcctgcaccacaagtcgcaaaaccagcagccactccagctgcagcacctgct
tcagaagaaggaagatcgtctcgtcgtgaaaaaatgacttcattgcgtaagacaatcgcc
aaacgtctggtggcagtaaaacaagaaacagcgatgctcacaaccttcaacgaggttgac
atgaaaccaatcatggatttaagagcaaaatataaagataaattcaaagaagtacacggc
gtaggtttaggctttatgtcgttcttcacgaaggcatgtgccattgcgttgaaggaattc
cctttggtaaattcatacatcgatggcgatgaaatcgtgtataacgactatgccgatatt
gcaattgcggtttctgctccacgtggtttggttgttccagtaattcgtagtgcagaaaaa
ctaaacttcgctcaaatcgagtcagaagtagttcgtttggcggtaaaagcacgtgaaaat
aagttgacaattgaagaaatgactggaggtaccttcacaattaccaatggtggtatcttt
ggttcgatgctttctacgccaattatcaacgctccacaatcagctatcttgggtatgcac
aacatcgttgagcgtccggtagtagtaaatggagaaatcgttgttcgcccaattatgtac
gtggctcttagctatgaccaccgcaccattgacggaaaagattcggttagtttcttagta
agagtaaaacaactcttagaagaccctactagaattcttttgggtgtgtaa

DBGET integrated database retrieval system