KEGG   Emticicia oligotrophica: Emtol_1282Help
Entry
Emtol_1282        CDS       T02272                                 

Definition
(GenBank) Glycoside hydrolase, family 20, catalytic core
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
eol  Emticicia oligotrophica
Pathway
eol00511  Other glycan degradation
eol00520  Amino sugar and nucleotide sugar metabolism
eol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Emtol_1282
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Emtol_1282
Enzymes [BR:eol01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Emtol_1282
Chaperones and folding catalysts [BR:eol03110]
 Intramolecular chaperones
  Others
   Emtol_1282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Fn3_assoc CHB_HEX_C_1 Glyco_hydro_67N STELLO Glycohydro_20b2 Glyco_hydro_97
Motif
Other DBs
NCBI-ProteinID: AFK02431
UniProt: I2ERX8
Position
complement(1113580..1115460)
Genome map
AA seq 626 aa AA seqDB search
MKQALVAVLCCAFINLKAQITPLNLIPQPVEVQQSAGSFALTNKTTISYNKAEAKVATDM
LIQRINTATGLMLKAQEGKTGMIQLNLNANTQLGKEGYTIEVTPKTVLVSANEAAGLFYG
MQTVLQLLPKEIESKSVIKANWTIPAVKITDYPRFAWRGIMLDVSRNFFTKEEVKKYIDN
IARFKYNTFHWHLTDDEGWRIEIKSLPKLTEVGAWRVARAGHFGDRDAPKPGEKATVGGY
YTQEDIKEVVKYAQERNVTIVPEIDVPGHSMAAIAAYPELSTTKNPNTFVNPGANIADWY
GNGTFKLRYENALNPSDEKVYEFLDKVMTEVAALFPNQYIHVGGDECYKGFWAADAGCQA
LMKKLGIRHVEDLQGYFMNRLEKILEAKGKKLIGWDEILEGGISPNATVMSWRGVKGGIE
AAHLGHEVVMTPTTFAYLDYNQGDNSVDPPIYAGLRVSKSYSFEPVPDGVDAKYILGGQG
NLWSEQLPTARYADYMTYPRAWALSEVYWSQKSAKNWDNFSKRMEAHFERADVAEINYSK
AAYDAIITAKMKDNKLVVELGSEIADLDIYYSIDDSMPDKYSSKYTQPIEMPDGPITLRV
ITYRAGKPIGHLITLKRAELERRAGK
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagccctcgtagcggtgctttgttgtgccttcatcaatttgaaggcacaaatc
acacccttaaatctgattccgcagccagttgaagtgcaacaaagtgcaggaagtttcgct
cttacaaacaaaacaacgatttcttataacaaagctgaggctaaagtagctactgacatg
ttgattcagagaatcaatacggctactggattgatgctaaaagcacaggaaggtaaaacg
ggtatgattcagttaaatttgaatgctaatacccaattaggtaaagaaggttatacgatt
gaagttactcctaaaacagtgcttgtaagtgctaatgaagcagctgggttgttttatggc
atgcaaacggtattacaacttttaccaaaagaaatcgagagtaaatcggttataaaagct
aattggacgattccagcagtaaaaattacagattatcctcgtttcgcgtggcgtggaatc
atgcttgatgtgagtcgtaatttcttcacaaaagaagaagtcaaaaagtatatcgataac
attgcacgtttcaaatataatacttttcactggcacttgacagatgacgaaggctggaga
attgaaatcaaatctttgccgaaactaacggaagtaggggcatggcgagtagctcgtgcg
ggccattttggcgaccgtgacgctccaaaacctggtgaaaaagcaaccgtaggaggttat
tatacgcaagaagatattaaagaagttgtaaaatatgctcaagagcgtaatgtgacgatt
gtccctgaaattgatgtgccaggccatagtatggcggcaattgctgcttatcctgaactc
agcacaaccaaaaatcctaatacatttgtaaatccaggagcgaatatagccgattggtac
ggtaatggaactttcaagttgcgttatgaaaatgctttgaatccatcagatgaaaaagta
tatgagtttttggataaagtaatgacagaagtagccgcacttttccctaatcagtatatt
catgttggtggcgatgagtgttataaaggtttctgggcagcagatgctggttgtcaggca
ttgatgaaaaaattgggcattcgccacgtagaagatctgcaagggtattttatgaatcgt
ttggagaaaattttagaagcaaaaggtaaaaaactcatcggttgggatgaaatcttagaa
ggtggaatttcgccaaatgctactgtaatgagttggagaggagtgaaggggggaattgag
gccgctcatctcggccatgaagttgtaatgacaccaacaacctttgcttatctagattat
aaccaaggtgacaatagtgttgacccaccgatttatgctggcttacgtgtgagtaaatcg
tatagttttgagccagtacctgatggtgttgatgccaaatatattttaggtggacaggga
aatctttggagcgaacagttaccaacagcacgctacgcggattatatgacttacccacgt
gcttgggcgttatcggaagtttattggtcacagaaatcagctaaaaattgggataatttc
agtaaacgtatggaggctcattttgagcgtgccgatgtggcagaaattaattattctaaa
gcggcttatgatgctatcattacggcaaagatgaaagacaataaattggtggttgaatta
ggaagcgaaatagctgacctagacatctattattcgattgacgattcaatgccagacaaa
tattcttctaaatacacacaaccaattgaaatgccagatggtccaatcacacttcgtgta
attacttatcgtgcaggaaagccaattggtcatttaattactttaaagcgagctgaatta
gaacgcagagctggaaagtaa

DBGET integrated database retrieval system