KEGG   Emticicia oligotrophica: Emtol_1494Help
Entry
Emtol_1494        CDS       T02272                                 

Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
eol  Emticicia oligotrophica
Pathway
eol00860  Porphyrin and chlorophyll metabolism
eol01100  Metabolic pathways
eol01110  Biosynthesis of secondary metabolites
eol01120  Microbial metabolism in diverse environments
Module
eol_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:eol00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Emtol_1494
Enzymes [BR:eol01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     Emtol_1494
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Emtol_1494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M DUF5575 Thioredoxin_13 Pyr_redox Pyr_redox_2 TFX_C GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AFK02640
UniProt: I2ESI7
Position
complement(1391308..1391874)
Genome map
AA seq 188 aa AA seqDB search
MNTLFPVFLKLEELHTLVVGGGNVGLEKLEAIFRNSPKAKVTLVAPEIREEIKALVSHHN
LTLIQEKYHISHLEGVNIVTAGTDSKEVNRQVRDDCKAKKILVNIADTPDLCDFYLSSVV
VKEDLKIAISTNGKSPTFAKRFREILEEIIPENLQETLNNLQAIRNKLKGDFQSKVQKLN
EITKVMQE
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaatacattatttccggtatttctaaaacttgaagaactacatacgcttgtagtgggt
ggaggaaatgtgggtttagaaaagctcgaagctattttcagaaattcaccaaaagcaaaa
gttacattggttgctcctgaaattcgtgaagaaataaaggctttagtttcgcaccataac
cttacgttgattcaagaaaaataccatatttctcatcttgagggggtaaatattgtaacg
gcaggaactgatagcaaagaagtaaatcgacaagtaagagatgattgtaaagctaaaaaa
atattagtcaatattgccgatacgcccgatttgtgcgatttttatttgagttcggttgtt
gtgaaagaagatttaaaaattgccatttccacaaatggaaaatcgcccacgtttgccaag
cgtttccgcgaaattttagaagaaattattcctgagaatttacaagaaaccttgaataat
ttgcaagcgattagaaataaactcaaaggtgattttcagagtaaagtacagaagcttaat
gagataacaaaagttatgcaagaatag

DBGET integrated database retrieval system