KEGG   Emticicia oligotrophica: Emtol_1550Help
Entry
Emtol_1550        CDS       T02272                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K12454  CDP-paratose 2-epimerase [EC:5.1.3.10]
Organism
eol  Emticicia oligotrophica
Pathway
eol00520  Amino sugar and nucleotide sugar metabolism
eol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Emtol_1550
Enzymes [BR:eol01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.10  CDP-paratose 2-epimerase
     Emtol_1550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 3Beta_HSD Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AFK02696
UniProt: I2ESP3
Position
1470217..1471278
Genome map
AA seq 353 aa AA seqDB search
MNIALVTGSAGLIGSESVAFFAEKFDLVIGIDNNLRSYFFGAEASTDWNRQGLEEKFSNY
KHYKADIRSEEEIGKIFAEYGADIKLVVHTAAQPSHDWAAREPFTDFTVNANGTLVLLES
TRKYCPEAVFIFTSTNKVYGDTPNYLPLVEQETRWEIDQNHPYFTNGIDELMSIDHSKHS
IFGASKVAADVMVQEYGRYFGMKTAVFRGGCLTGPNHSGAQLHGFLAYLMKCAITGNHYT
IFGYKGKQVRDNIHSWDLVNMFWHFYQNPRAGEVYNAGGGRFSNCSMQEGITLCEEITGN
KMKYSYAEDNRSGDHIWYISDLTKFKSHYPDWTWKYDLKTTLTQMYDNISKRV
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaacatagcattggtaacaggctcggcaggattgattggtagtgaatccgttgccttt
ttcgccgaaaaattcgacttagtcattggtattgataataatcttcgctcttatttcttt
ggtgcagaagcatctactgattggaatcgccaaggtttagaagaaaagtttagcaattac
aagcactacaaagctgatatccgttcggaagaagaaattggtaaaatcttcgcagaatat
ggtgcagatattaaattggttgttcatacagctgctcaaccaagccacgactgggctgct
cgtgaaccattcaccgattttacggtaaatgccaatggtacacttgtattacttgagtca
acacgtaaatattgcccagaagcagtattcattttcacttctacaaataaggtgtatggc
gatacgccaaattatctacctttagtagaacaagaaactcgctgggaaattgaccaaaat
cacccatatttcaccaatggtattgatgagttgatgtcgattgaccactcaaaacactct
atttttggagcttcaaaagtggctgccgatgtaatggtacaggaatatggtagatatttc
ggcatgaaaaccgcggtatttcgtggaggttgcttaactggcccgaatcactctggtgct
cagctacatggtttcttggcttatttaatgaaatgtgcaattactggcaatcattatacc
attttcggctacaaaggcaaacaagtacgtgataatatccatagctgggacttagtgaat
atgttctggcatttctaccaaaacccacgtgcgggcgaggtttataatgcaggtggtggc
cgtttctcgaactgttcgatgcaagaaggtattactttgtgcgaagaaatcacgggtaat
aaaatgaaatatagctacgccgaagataatcgtagtggcgaccacatctggtatatctct
gaccttacgaagtttaagagtcattatccagattggacttggaaatatgacctcaaaaca
acgctcacgcagatgtatgataatatcagcaaacgtgtttaa

DBGET integrated database retrieval system