KEGG   Emticicia oligotrophica: Emtol_2781Help
Entry
Emtol_2781        CDS       T02272                                 

Definition
(GenBank) nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
eol  Emticicia oligotrophica
Pathway
eol00633  Nitrotoluene degradation
eol01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eol00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Emtol_2781
Enzymes [BR:eol01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     Emtol_2781
  1.-  
   1.-.-  
    1.-.-.-  
     Emtol_2781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AFK03916
UniProt: I2EW63
Position
2965764..2966363
Genome map
AA seq 199 aa AA seqDB search
MDFLALAKSRYTTKKYNPSKKVSEADIEALKEIIRLSPSSINSQPWKFYFVSENSLKSSL
ADASIFNKPKVDDASHVVVFCAIDDVQLFEEKIQKNLPEGAVAYYKQHIKPLSEAEIKSW
FGHQVYLALGFFLSACAAMGIDSTPMEGIENEKYAEILKLEGYKPLFAVAIGYRNVEDAN
QPSVKPKYRFVAEDVVESI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggattttttagcattagcaaaaagtagatatactacaaaaaagtataacccctctaaa
aaggtttcggaggcagatattgaagcattaaaagagattattcgattaagtccatcatct
atcaatagccagccttggaagttttattttgtttctgaaaatagtctgaaaagcagttta
gcagatgcgtctattttcaataaacctaaggttgatgacgcaagtcacgtcgtagttttc
tgtgcaattgatgatgtgcaattatttgaagagaaaattcagaagaatttgcctgaaggt
gcagtagcttattacaaacaacacatcaaacctctttctgaagctgagattaaatcttgg
tttgggcatcaagtatatcttgcattgggtttctttttaagtgcctgtgccgctatggga
atagactctacgccaatggaaggaattgaaaacgaaaaatatgccgaaattttaaaactt
gaagggtataagcctctatttgcagtggctattggttatagaaatgtagaagatgcgaat
cagccaagtgtgaagcctaaatatagatttgtggcagaagatgtggtagaaagtatttga

DBGET integrated database retrieval system