KEGG   Emticicia oligotrophica: Emtol_3739Help
Entry
Emtol_3739        CDS       T02272                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
eol  Emticicia oligotrophica
Pathway
eol00020  Citrate cycle (TCA cycle)
eol00640  Propanoate metabolism
eol00660  C5-Branched dibasic acid metabolism
eol01100  Metabolic pathways
eol01110  Biosynthesis of secondary metabolites
eol01120  Microbial metabolism in diverse environments
eol01130  Biosynthesis of antibiotics
eol01200  Carbon metabolism
Module
eol_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eol_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Emtol_3739
   00640 Propanoate metabolism
    Emtol_3739
   00660 C5-Branched dibasic acid metabolism
    Emtol_3739
Enzymes [BR:eol01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Emtol_3739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AFK04865
UniProt: I2EYW2
Position
4099398..4100618
Genome map
AA seq 406 aa AA seqDB search
MNVHEYQGKEILSRYGVRIQRGIVAETPEQAVAAYQQIAEMTNSKFAVVKSQIHAGGRGK
GNIVGSEQRGVQLAKSADDVQRISTNLLGNVLVTIQTGAEGKKVNKVLVAEDAYYPGESE
PKEYYMGILLDRAKGCNVIMASTEGGMDIEEVAEHHPEKIFKEWVDPRVGLQPFQARKIA
DKLGLTGTANKEMVKFVSSLYQAYVESDSSMFEINPVLKTSDNKILAVDAKVNLDDNALY
RHADLAAMRDKSEEDPLEVEASESDLNYVKLDGNVGCMVNGAGLAMATMDIIKLSGGEPA
NFLDVGGGANAKTVEAGFRIILKDPNVKAILINIFGGIVRCDRVANGVVEAYKAIGEIPV
PIIVRLQGTNAAEGAKIIDESGLKVYSAIALKEAAELVEKVLGESK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttcacgagtatcaaggtaaagaaatactaagccgttatggtgtacgtatccaa
cgcggtatcgtagccgaaacgccagagcaggcagtagctgcctatcagcaaatcgccgaa
atgactaactctaagtttgccgttgtgaaatctcaaattcatgcgggtggacgtggaaag
ggtaatatcgtaggctctgagcaaagaggtgtacaattagccaaatctgctgatgatgta
caacgtatctcaacaaatttgcttggaaatgtattagttacaatccaaacaggagccgaa
ggaaagaaagtaaataaggttttagttgctgaagatgcttattatcctggcgaaagtgag
ccaaaagaatattacatgggtattttgcttgatagagcaaaaggatgtaatgtgatcatg
gcttctactgaaggtggtatggatatcgaagaggtagctgagcatcatccagaaaaaata
tttaaagaatgggttgacccacgcgttggtttgcaacctttccaagcacgtaaaattgct
gataaattaggtttgactggtactgccaataaagaaatggttaaattcgtttcttctctg
tatcaagcttatgttgagtctgactcatcaatgtttgaaatcaacccagtattgaaaact
tctgataataaaattttagcagttgatgctaaagtaaatttagatgacaatgctttgtat
cgtcatgctgatttagctgctatgcgtgataaatcagaagaagatccattggaagtagaa
gcttctgaaagcgaccttaactatgtaaaactagacggaaacgttggttgtatggtaaat
ggtgctggtttggctatggctacaatggatatcatcaaactttcgggtggtgagcctgca
aacttccttgatgtaggtggtggtgctaatgctaaaacggttgaagctggtttcagaatt
atcttgaaagacccgaacgtaaaagctattttaatcaacatctttggtggtatcgttcgt
tgcgaccgtgttgctaatggtgtggttgaagcttacaaagcaattggcgaaattccagtg
ccaattatcgttcgtttacaaggtacaaatgcagccgaaggtgcgaaaatcatcgacgag
tctggtttgaaagtttattcggcaattgcattaaaagaagctgctgaattagtagagaaa
gttttgggcgaatctaagtaa

DBGET integrated database retrieval system